RegulonDB RegulonDB 10.8: Gene Form
   

ybiB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dinG hcxB ybiB TSS_962 TSS_962 TSS_961 TSS_961 TSS_960 TSS_960 dinGp dinGp

Gene      
Name: ybiB    Texpresso search in the literature
Synonym(s): ECK0789, EG11580, b0800
Genome position(nucleotides): 835248 --> 836210 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.66
External database links:  
ASAP:
ABE-0002734
ECHOBASE:
EB1540
OU-MICROARRAY:
b0800
PortEco:
ybiB
STRING:
511145.b0800
COLOMBOS: ybiB


Product      
Name: nonspecific DNA-binding protein YbiB
Synonym(s): YbiB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.049
Isoelectric point: 6.854
Motif(s):
 
Type Positions Sequence
5 -> 69 KIIKEIGRGKNHARDLDRDTARGLYAHMLNGEVPDLELGGVLIALRIKGEGEAEMLGFYEAMQNH

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0003723 - RNA binding
GO:0042803 - protein homodimerization activity
biological_process GO:0000162 - tryptophan biosynthetic process
External database links:  
DIP:
DIP-11425N
ECOCYC:
EG11580-MONOMER
ECOLIWIKI:
b0800
INTERPRO:
IPR035902
INTERPRO:
IPR017459
INTERPRO:
IPR036320
MODBASE:
P30177
PDB:
4MUO
PFAM:
PF02885
PRIDE:
P30177
REFSEQ:
NP_415321
SMR:
P30177
UNIPROT:
P30177


Operon      
Name: dinG-ybiB         
Operon arrangement:
Transcription unit        Promoter
dinG-ybiB
ybiB


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_960 833795 forward nd [RS-EPT-CBR] [1]
  promoter TSS_961 835181 forward nd [RS-EPT-CBR] [1]
  promoter TSS_962 836318 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB