RegulonDB RegulonDB 10.8: Gene Form
   

gcl gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gcl allR hyi AllR terminator anti-terminator TSS_673 TSS_673 TSS_672 TSS_672 gclp gclp TSS_671 TSS_671

Gene      
Name: gcl    Texpresso search in the literature
Synonym(s): ECK0500, EG11583, b0507
Genome position(nucleotides): 533916 --> 535697 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.92
External database links:  
ASAP:
ABE-0001754
CGSC:
31107
ECHOBASE:
EB1542
OU-MICROARRAY:
b0507
PortEco:
gcl
STRING:
511145.b0507
COLOMBOS: gcl


Product      
Name: glyoxylate carboligase
Synonym(s): Gcl
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 64.732
Isoelectric point: 5.982
Motif(s):
 
Type Positions Sequence
393 -> 553 IGLSQIAAAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPKRNVVAISGDFDFQFLIEELAVGAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSSEVNGYGVDHVKVAEGLGCKAIRVFKPEDIAPAFEQAKALMAQYRVPVVVEV
4 -> 172 MRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKHGGIRHILARHVEGASHMAEGYTRATAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQAPRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLVDLPFDVQVAEIE
193 -> 329 IEKAVEMLIQAERPVIVAGGGVINADAAALLQQFAELTSVPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMVFGIGNRFANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKAALTLL
2 -> 593 AKMRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKHGGIRHILARHVEGASHMAEGYTRATAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQAPRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLVDLPFDVQVAEIEFDPDMYEPLPVYKPAASRMQIEKAVEMLIQAERPVIVAGGGVINADAAALLQQFAELTSVPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMVFGIGNRFANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAGRLPCRKEWVADCQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFGRDVCYVTTIGLSQIAAAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPKRNVVAISGDFDFQFLIEELAVGAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSSEVNGYGVDHVKVAEGLGCKAIRVFKPEDIAPAFEQAKALMAQYRVPVVVEVILERVTNISMGSELDNVMEFEDIADNAADAPTETCFMHYE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.21 - glyoxylate degradation
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.25 - glycolate metabolism
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0009028 - tartronate-semialdehyde synthase activity
GO:0000287 - magnesium ion binding
GO:0030976 - thiamine pyrophosphate binding
GO:0042802 - identical protein binding
GO:0071949 - FAD binding
biological_process GO:0009436 - glyoxylate catabolic process
GO:0046296 - glycolate catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48112N
ECOCYC:
GLYOCARBOLIG-MONOMER
ECOLIWIKI:
b0507
INTERPRO:
IPR029061
INTERPRO:
IPR029035
INTERPRO:
IPR012001
INTERPRO:
IPR012000
INTERPRO:
IPR011766
INTERPRO:
IPR006397
MINT:
MINT-1302810
PANTHER:
PTHR18968:SF14
PDB:
2PAN
PFAM:
PF00205
PFAM:
PF02775
PFAM:
PF02776
PRIDE:
P0AEP7
PRODB:
PRO_000022761
REFSEQ:
NP_415040
SMR:
P0AEP7
UNIPROT:
P0AEP7


Operon      
Name: gcl-hyi-glxR-ybbW-allB-ybbY-glxK         
Operon arrangement:
Transcription unit        Promoter
gcl-hyi-glxR-ybbVW-allB-ybbY-glxK
allB
allB
allB
ybbY-glxK
glxK


Transcriptional Regulation      
Display Regulation             
Repressed by: AllR
Growth Conditions:

[1] 

C: Escherichia coli| allS knockout mutant| minimal medium| D-xylose 120 µM; ammonium sulfate 20 mM| mid exponential phase
E: Escherichia coli| allS knockout mutant| minimal medium| D-xylose 120 µM; ammonium sulfate 20 mM; glyoxylate| mid exponential phase

[2] 

C: Escherichia coli| minimal medium| D-xylose 120 µM; ammonium sulfate 20 mM| mid exponential phase
E: Escherichia coli| minimal medium| D-xylose 120 µM; ammonium sulfate 20 mM; glyoxylate| mid exponential phase



RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_671 533637 forward nd [RS-EPT-CBR] [1]
  promoter TSS_672 534816 forward nd [RS-EPT-CBR] [1]
  promoter TSS_673 534825 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muńiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB