RegulonDB RegulonDB 10.8: Gene Form
   

moaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

moaA moaB moaC moaD Cis-reg; riboswitch TSS_948 (cluster) TSS_948 (cluster) moaBp moaBp

Gene      
Name: moaB    Texpresso search in the literature
Synonym(s): ECK0771, EG11596, b0782, chlA2
Genome position(nucleotides): 818055 --> 818567 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.05
External database links:  
ASAP:
ABE-0002671
CGSC:
31222
ECHOBASE:
EB1553
OU-MICROARRAY:
b0782
PortEco:
moaB
STRING:
511145.b0782
COLOMBOS: moaB


Product      
Name: protein MoaB
Synonym(s): MoaB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.665
Isoelectric point: 6.008
Motif(s):
 
Type Positions Sequence
14 -> 156 AILTVSNRRGEEDDTSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQVSAWIASDDVQVVLITGGTGLTEGDQAPEALLPLFDREVEGFGEVFRMLSFEEIGTSTLQSRAVAGVANKTLIFAMPGSTKACRTAWENIIAPQLD
2 -> 170 SQVSTEFIPTRIAILTVSNRRGEEDDTSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQVSAWIASDDVQVVLITGGTGLTEGDQAPEALLPLFDREVEGFGEVFRMLSFEEIGTSTLQSRAVAGVANKTLIFAMPGSTKACRTAWENIIAPQLDARTRPCNFHPHLKK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.4 - molybdenum
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0042802 - identical protein binding
biological_process GO:0006777 - Mo-molybdopterin cofactor biosynthetic process
GO:0034214 - protein hexamerization
External database links:  
ECOCYC:
MONOMER0-1501
ECOLIWIKI:
b0782
INTERPRO:
IPR012245
INTERPRO:
IPR001453
INTERPRO:
IPR008284
INTERPRO:
IPR036425
INTERPRO:
IPR013484
MINT:
MINT-1301713
PANTHER:
PTHR43232
PDB:
1MKZ
PDB:
1R2K
PFAM:
PF00994
PRIDE:
P0AEZ9
PRODB:
PRO_000023261
PROSITE:
PS01078
REFSEQ:
NP_415303
SMART:
SM00852
SMR:
P0AEZ9
SWISSMODEL:
P0AEZ9
UNIPROT:
P0AEZ9


Operon      
Name: moaABCDE         
Operon arrangement:
Transcription unit        Promoter
moaABCDE
moaABCDE
moaBCDE


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ModE
Repressed by: CueR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_948 (cluster) 818012 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB