RegulonDB RegulonDB 10.8: Gene Form
   

moaD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

moaB moaC moaE moaD

Gene      
Name: moaD    Texpresso search in the literature
Synonym(s): ECK0773, EG11597, b0784, chlA4, chlM
Genome position(nucleotides): 819048 --> 819293 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.69
External database links:  
ASAP:
ABE-0002675
CGSC:
18475
ECHOBASE:
EB1554
OU-MICROARRAY:
b0784
PortEco:
moaD
STRING:
511145.b0784
COLOMBOS: moaD


Product      
Name: molybdopterin synthase sulfur carrier subunit
Synonym(s): ChlM, MoaD, molybdopterin synthase small subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.758
Isoelectric point: 4.164
Motif(s):
 
Type Positions Sequence
45 -> 45 A
9 -> 9 Q
4 -> 81 VLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.4 - molybdenum
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0000166 - nucleotide binding
biological_process GO:0006777 - Mo-molybdopterin cofactor biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Pitterle DM., et al., 1989
External database links:  
DIP:
DIP-10231N
ECOCYC:
EG11597-MONOMER
ECOLIWIKI:
b0784
INTERPRO:
IPR003749
INTERPRO:
IPR012675
INTERPRO:
IPR016155
MINT:
MINT-155528
MODBASE:
P30748
PDB:
3BII
PDB:
1NVI
PDB:
1JWB
PDB:
1JW9
PDB:
1FMA
PDB:
1FM0
PDB:
1JWA
PFAM:
PF02597
PRIDE:
P30748
REFSEQ:
NP_415305
SMR:
P30748
UNIPROT:
P30748


Operon      
Name: moaABCDE         
Operon arrangement:
Transcription unit        Promoter
moaABCDE
moaABCDE
moaBCDE


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, ModE
Repressed by: CueR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Pitterle DM., Rajagopalan KV., 1989, Two proteins encoded at the chlA locus constitute the converting factor of Escherichia coli chlA1., J Bacteriol 171(6):3373-8


RegulonDB