RegulonDB RegulonDB 10.6.3: Gene Form
   

marB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eamA marA marB

Gene      
Name: marB    Texpresso search in the literature
Synonym(s): ECK1525, EG11599, b1532
Genome position(nucleotides): 1619989 --> 1620207 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.23
External database links:  
ASAP:
ABE-0005114
CGSC:
32217
ECHOBASE:
EB1556
ECOCYC:
EG11599
ECOLIHUB:
marB
OU-MICROARRAY:
b1532
REGULONDB:
b1532
STRING:
511145.b1532
M3D: marB
COLOMBOS: marB
PortEco: b1532


Product      
Name: multiple antibiotic resistance protein
Synonym(s): MarB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 7.537
Isoelectric point: 5.385
Motif(s):
 
Type Positions Sequence
6 -> 70 SAIAAALILFSAQGVAEQTTQPVVTSCANVVVVPPSQEHPPFDLNHMGTGSDKSDALGVPYYNQH

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
biological_process GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11599-MONOMER
ECOLIWIKI:
b1532
INTERPRO:
IPR025732
PFAM:
PF13999
PRIDE:
P31121
PRODOM:
PD027692
PROTEINMODELPORTAL:
P31121
REFSEQ:
NP_416049
UNIPROT:
P31121


Operon      
Name: marRAB         
Operon arrangement:
Transcription unit        Promoter
marRAB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, MarA, CpxR, Rob, SoxS, Fis
Repressed by: Cra, AcrR, MarR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB