RegulonDB RegulonDB 10.8: Gene Form
   

sseA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sseA yfhM IS129 ryfA IS128 C0614 sseB ryfAp11 ryfAp11 TSS_2822 (cluster) TSS_2822 (cluster) sseAp sseAp yfhMp yfhMp TSS_2821 (cluster) TSS_2821 (cluster) TSS_2820 TSS_2820

Gene      
Name: sseA    Texpresso search in the literature
Synonym(s): ECK2517, EG11600, b2521, mstA
Genome position(nucleotides): 2652494 --> 2653339 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.19
External database links:  
ASAP:
ABE-0008299
CGSC:
33023
ECHOBASE:
EB1557
MIM:
249650
OU-MICROARRAY:
b2521
PortEco:
sseA
STRING:
511145.b2521
COLOMBOS: sseA


Product      
Name: 3-mercaptopyruvate sulfurtransferase
Synonym(s): MstA, SseA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.812
Isoelectric point: 4.304
Motif(s):
 
Type Positions Sequence
17 -> 135 DDPEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAMRELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLAGWQRDDLLLEE
9 -> 128 ADWLAEHIDDPEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAMRELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLAGWQR
238 -> 244 CGSGVTA
240 -> 240 S
2 -> 281 STTWFVGADWLAEHIDDPEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAMRELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAFNPEAVVKVTDVLLASHENTAQIIDARPAARFNAEVDEPRPGLRRGHIPGALNVPWTELVREGELKTTDELDAIFFGRGVSYDKPIIVSCGSGVTAAVVLLALATLDVPNVKLYDGAWSEWGARADLPVEPVK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0004792 - thiosulfate sulfurtransferase activity
GO:0016784 - 3-mercaptopyruvate sulfurtransferase activity
biological_process GO:0042262 - DNA protection
GO:0006979 - response to oxidative stress
GO:0046677 - response to antibiotic
GO:0019346 - transsulfuration
Note(s): Note(s): ...[more].
Reference(s): [1] Borgese N., et al., 2010
External database links:  
DIP:
DIP-10921N
ECOCYC:
EG11600-MONOMER
ECOLIWIKI:
b2521
INTERPRO:
IPR001307
INTERPRO:
IPR036873
INTERPRO:
IPR001763
MINT:
MINT-1289054
MODBASE:
P31142
PDB:
1URH
PFAM:
PF00581
PRIDE:
P31142
PROSITE:
PS00683
PROSITE:
PS50206
PROSITE:
PS00380
REFSEQ:
NP_417016
SMART:
SM00450
SMR:
P31142
UNIPROT:
P31142


Operon      
Name: sseA         
Operon arrangement:
Transcription unit        Promoter
sseA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2820 2651918 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2821 (cluster) 2651928 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2822 (cluster) 2652468 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter ryfAp11 2653699 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Borgese N., Righi M., 2010, Remote origins of tail-anchored proteins., Traffic 11(7):877-85

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB