RegulonDB RegulonDB 10.7: Gene Form
   

yciI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kch tonB yciI Fur Fur Fur Fur anti-anti-terminator anti-terminator terminator TSS_1684 TSS_1684 tonBp tonBp yciIp yciIp kchp kchp

Gene      
Name: yciI    Texpresso search in the literature
Synonym(s): ECK1245, EG11607, b1251
Genome position(nucleotides): 1310569 <-- 1310865 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.82
External database links:  
ASAP:
ABE-0004192
ECHOBASE:
EB1564
OU-MICROARRAY:
b1251
PORTECO:
yciI
REGULONDB:
b1251
STRING:
511145.b1251
M3D: yciI
COLOMBOS: yciI
PortEco: b1251


Product      
Name: protein YciI
Synonym(s): YciI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.602
Isoelectric point: 5.054
Motif(s):
 
Type Positions Sequence
1 -> 95 MLYVIYAQDKADSLEKRLSVRPAHLARLQLLHDEGRLLTAGPMPAVDSNDPGAAGFTGSTVIAEFESLEAAQAWADADPYVAAGVYEHVSVKPFK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35954N
ECOCYC:
EG11607-MONOMER
ECOLIWIKI:
b1251
INTERPRO:
IPR005545
INTERPRO:
IPR011008
MINT:
MINT-1309557
MODBASE:
P0AB55
PFAM:
PF03795
PRIDE:
P0AB55
PROTEINMODELPORTAL:
P0AB55
REFSEQ:
NP_415767
SMR:
P0AB55
SWISSMODEL:
P0AB55
UNIPROT:
P0AB55


Operon      
Name: yciI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter kchp 1310523 reverse We assigned a putative transcription
Read more >
[AIPP] [1]
  promoter TSS_1684 1311057 forward nd [RS-EPT-CBR] [2]


Evidence    

 [AIPP] Automated inference of promoter position

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Reitzer L., Schneider BL., 2001, Metabolic context and possible physiological themes of sigma(54)-dependent genes in Escherichia coli., Microbiol Mol Biol Rev 65(3):422-44, table of contents

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB