RegulonDB RegulonDB 10.7: Gene Form
   

clsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

clsA yciU yciY TSS_1682 (cluster) TSS_1682 (cluster) clsAp clsAp TSS_1681 TSS_1681 TSS_1680 TSS_1680 TSS_1679 TSS_1679 TSS_1678 TSS_1678 TSS_1677 TSS_1677 yciUp4 yciUp4 yciUp5 yciUp5 yciUp6 yciUp6 TSS_1676 TSS_1676 TSS_1675 (cluster) TSS_1675 (cluster)

Gene      
Name: clsA    Texpresso search in the literature
Synonym(s): ECK1243, EG11608, b1249, cls, nov, yciJ
Genome position(nucleotides): 1307185 <-- 1308645 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.68
External database links:  
ASAP:
ABE-0004186
CGSC:
915
ECHOBASE:
EB1565
OU-MICROARRAY:
b1249
PORTECO:
cls
REGULONDB:
b1249
STRING:
511145.b1249
M3D: clsA
COLOMBOS: clsA
PortEco: b1249


Product      
Name: cardiolipin synthase A
Synonym(s): Cls, ClsA, Nov, YciJ, cardiolipin synthase 1
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 54.822
Isoelectric point: 8.434
Motif(s):
 
Type Positions Sequence
30 -> 32 KRR
331 -> 446 YSAREYLIMTTPYFVPSDDLLHAICTAAQRGVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTVNLDMRSLWLNFEITLAIDDKGFGADL
2 -> 60 TTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE
23 -> 59 VTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVG
38 -> 58 MAWLLIIYILPLVGIIAYLAV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
GO:0008808 - cardiolipin synthase activity
biological_process GO:0006629 - lipid metabolic process
GO:0008654 - phospholipid biosynthetic process
GO:0032049 - cardiolipin biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Babu M., et al., 2011
[2] Heber S., et al., 1991
[3] Hiraoka S., et al., 1993
[4] Homma H., et al., 1982
[5] Li C., et al., 2016
[6] Rakonjac J., et al., 1992
[7] Shibuya I., et al., 1992
[8] Shibuya I., et al., 1985
External database links:  
ECOCYC:
CARDIOLIPSYN-MONOMER
ECOLIWIKI:
b1249
INTERPRO:
IPR025202
INTERPRO:
IPR022924
INTERPRO:
IPR001736
INTERPRO:
IPR027379
INTERPRO:
IPR030840
MODBASE:
P0A6H8
PFAM:
PF13396
PFAM:
PF13091
PRIDE:
P0A6H8
PROSITE:
PS50035
PROTEINMODELPORTAL:
P0A6H8
REFSEQ:
NP_415765
SMART:
SM00155
SMR:
P0A6H8
UNIPROT:
P0A6H8


Operon      
Name: clsA-yciU         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1675 (cluster) 1307175 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter TSS_1676 1307286 reverse nd [RS-EPT-CBR] [9]
  promoter yciUp6 1307349 reverse Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter yciUp5 1307352 reverse Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter yciUp4 1307359 reverse Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter TSS_1677 1307454 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_1678 1307894 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_1679 1307905 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_1680 1307924 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_1681 1308634 reverse nd [RS-EPT-CBR] [9]
  promoter TSS_1682 (cluster) 1308761 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Babu M., Diaz-Mejia JJ., Vlasblom J., Gagarinova A., Phanse S., Graham C., Yousif F., Ding H., Xiong X., Nazarians-Armavil A., Alamgir M., Ali M., Pogoutse O., Pe'er A., Arnold R., Michaut M., Parkinson J., Golshani A., Whitfield C., Wodak SJ., Moreno-Hagelsieb G., Greenblatt JF., Emili A., 2011, Genetic interaction maps in Escherichia coli reveal functional crosstalk among cell envelope biogenesis pathways., PLoS Genet 7(11):e1002377

 [2] Heber S., Tropp BE., 1991, Genetic regulation of cardiolipin synthase in Escherichia coli., Biochim Biophys Acta 1129(1):1-12

 [3] Hiraoka S., Matsuzaki H., Shibuya I., 1993, Active increase in cardiolipin synthesis in the stationary growth phase and its physiological significance in Escherichia coli., FEBS Lett 336(2):221-4

 [4] Homma H., Nojima S., 1982, Synthesis of various phospholipids from 2-acyl lysophospholipids by Escherichia coli extract., J Biochem 91(4):1103-10

 [5] Li C., Tan BK., Zhao J., Guan Z., 2016, In Vivo and in Vitro Synthesis of Phosphatidylglycerol by an Escherichia coli Cardiolipin Synthase., J Biol Chem 291(48):25144-25153

 [6] Rakonjac J., Milic M., Ajdic-Predic D., Santos D., Ivanisevic R., Savic DJ., 1992, nov: a new genetic locus that affects the response of Escherichia coli K-12 to novobiocin., Mol Microbiol 6(11):1547-53

 [7] Shibuya I., Hiraoka S., 1992, Cardiolipin synthase from Escherichia coli., Methods Enzymol 209:321-30

 [8] Shibuya I., Yamagoe S., Miyazaki C., Matsuzaki H., Ohta A., 1985, Biosynthesis of novel acidic phospholipid analogs in Escherichia coli., J Bacteriol 161(2):473-7

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [10] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB