RegulonDB RegulonDB 11.0: Gene Form
   

evgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

evgS emrK evgA evgL EvgA TSS_2669 TSS_2669 TSS_2668 (cluster) TSS_2668 (cluster) evgAp1 evgAp1 TSS_2666 TSS_2666 evgAp2 evgAp2 TSS_2665 TSS_2665 emrKp emrKp emrYp1 emrYp1

Gene      
Name: evgA    Texpresso search in the literature
Synonym(s): ECK2365, EG11609, b2369
Genome position(nucleotides): 2483755 --> 2484369
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.0
External database links:  
ASAP:
ABE-0007817
CGSC:
32763
ECHOBASE:
EB1566
ECOLIHUB:
evgA
OU-MICROARRAY:
b2369
STRING:
511145.b2369
COLOMBOS: evgA


Product      
Name: DNA-binding transcriptional activator EvgA
Synonym(s): EvgA, EvgA response regulator
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol
Molecular weight: 22.69
Isoelectric point: 7.439
Motif(s):
 
Type Positions Sequence Comment
2 -> 117 NAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAK UniProt: Response regulatory.
4 -> 114 IIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIE
137 -> 202 DQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNK UniProt: HTH luxR-type.
142 -> 198 DSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFA
161 -> 180 NNDIAEKMFISNKTVSTYKS UniProt: H-T-H motif.

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
External database links:  
ALPHAFOLD:
P0ACZ4
DIP:
DIP-48087N
ECOCYC:
EVGA-MONOMER
ECOLIWIKI:
b2369
INTERPRO:
IPR001789
INTERPRO:
IPR011006
INTERPRO:
IPR016032
INTERPRO:
IPR000792
INTERPRO:
IPR036388
MODBASE:
P0ACZ4
PDB:
3F6C
PFAM:
PF00072
PFAM:
PF00196
PRIDE:
P0ACZ4
PRINTS:
PR00038
PRODB:
PRO_000022552
PROSITE:
PS00622
PROSITE:
PS50043
PROSITE:
PS50110
REFSEQ:
NP_416870
SMART:
SM00421
SMART:
SM00448
SMR:
P0ACZ4
UNIPROT:
P0ACZ4


Operon      
Name: evgAS         
Operon arrangement:
Transcription unit        Promoter
evgAS
evgAS


Transcriptional Regulation      
Display Regulation             
Activated by: EvgA
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter emrYp1 2482334 reverse nd [ICWHO] [1]
  promoter TSS_2665 2483630 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2666 2483632 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2668 (cluster) 2483646 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2669 2485186 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB