RegulonDB RegulonDB 10.6.3: Gene Form
   

evgS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

evgS yfdE evgA TSS_2669 TSS_2669

Gene      
Name: evgS    Texpresso search in the literature
Synonym(s): ECK2366, EG11610, b2370
Genome position(nucleotides): 2484374 --> 2487967 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.82
External database links:  
ASAP:
ABE-0007819
CGSC:
32766
ECHOBASE:
EB1567
ECOCYC:
EG11610
ECOLIHUB:
evgS
OU-MICROARRAY:
b2370
REGULONDB:
b2370
STRING:
511145.b2370
M3D: evgS
COLOMBOS: evgS
PortEco: b2370


Product      
Name: sensory histidine kinase EvgS
Synonym(s): EvgS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 134.742
Isoelectric point: 6.16
Motif(s):
 
Type Positions Sequence
22 -> 1197 DEDYIEYRGISSNNRVTLDPLRLSNKELRWLASKKNLVIAVHKSQTATLLHTDSQQRVRGINADYLNLLKRALNIKLTLREYADHQKAMDALAEGEVDIVLSHLVTSPPLNNDIAATKPLIITFPALVTTLHDSMRPLTSPKPVNIARVANYPPDEVIHQSFPKATIISFTNLYQALASVSAGHNDYFIGSNIITSSMISRYFTHSLNVVKYYNSPRQYNFFLTRKESVILNEVLNRFVDALTNEVRYEVSQNWLDTGNLAFLNKPLELTEHEKQWIKQHPNLKVLENPYSPPYSMTDENGSVRGVMGDILNIITLQTGLNFSPITVSHNIHAGTQLSPGGWDIIPGAIYSEDRENNVLFAEAFITTPYVFVMQKAPDSEQTLKKGMKVAIPYYYELHSQLKEMYPEVEWIQVDNASAAFHKVKEGELDALVATQLNSRYMIDHYYPNELYHFLIPGVPNASLSFAFPRGEPELKDIINKALNAIPPSEVLRLTEKWIKMPNVTIDTWDLYSEQFYIVTTLSVLLVGSSLLWGFYLLRSVRRRKVIQGDLENQISFRKALSDSLPNPTYVVNWQGNVISHNSAFEHYFTADYYKNAMLPLENSDSPFKDVFSNAHEVTAETKENRTIYTQVFEIDNGIEKRCINHWHTLCNLPASDNAVYICGWQDITETRDLINALEVEKNKAIKATVAKSQFLATMSHEIRTPISSIMGFLELLSGSGLSKEQRVEAISLAYATGQSLLGLIGEILDVDKIESGNYQLQPQWVDIPTLVQNTCHSFGAIAASKSIALSCSSTFPEHYLVKIDPQAFKQVLSNLLSNALKFTTEGAVKITTSLGHIDDNHAVIKMTIMDSGSGLSQEEQQQLFKRYSQTSAGRQQTGSGLGLMICKELIKNMQGDLSLESHPGIGTTFTITIPVEISQQVATVEAKAEQPITLPEKLSILIADDHPTNRLLLKRQLNLLGYDVDEATDGVQALHKVSMQHYDLLITDVNMPNMDGFELTRKLREQNSSLPIWGLTANAQANEREKGLSCGMNLCLFKPLTLDVLKTHLSQLHQVAHIAPQYRHLDIEALKNNTANDLQLMQEILMTFQHETHKDLPAAFQALEAGDNRTFHQCIHRIHGAANILNLQKLINISHQLEITPVSDDSKPEILQLLNSVKEHIAELDQEIAVFCQKND
758 -> 758 G
1104 -> 1160 EILMTFQHETHKDLPAAFQALEAGDNRTFHQCIHRIHGAANILNLQKLINISHQLEI
275 -> 275 W
420 -> 421 SQ

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0009927 - histidine phosphotransfer kinase activity
biological_process GO:0010038 - response to metal ion
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0010447 - response to acidic pH
GO:0023014 - signal transduction by protein phosphorylation
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
Reference(s): [1] Bock A., et al., 2002
[2] Eguchi Y., et al., 2003
[3] Kinoshita-Kikuta E., et al., 2016
[4] Perraud AL., et al., 1998
[5] Sen H., et al., 2017
[6] Tanabe H., et al., 1998
External database links:  
DIP:
DIP-9545N
ECOCYC:
EVGS-MONOMER
ECOLIWIKI:
b2370
INTERPRO:
IPR001638
INTERPRO:
IPR036097
INTERPRO:
IPR011006
INTERPRO:
IPR008207
INTERPRO:
IPR005467
INTERPRO:
IPR004358
INTERPRO:
IPR003661
INTERPRO:
IPR003594
INTERPRO:
IPR036890
INTERPRO:
IPR036641
INTERPRO:
IPR001789
MINT:
MINT-1288120
MODBASE:
P30855
PFAM:
PF00072
PFAM:
PF00497
PFAM:
PF00512
PFAM:
PF01627
PFAM:
PF02518
PRIDE:
P30855
PRINTS:
PR00344
PRODB:
PRO_000022553
PROSITE:
PS50894
PROSITE:
PS50110
PROSITE:
PS50109
PROTEINMODELPORTAL:
P30855
REFSEQ:
NP_416871
SMART:
SM00062
SMART:
SM00387
SMART:
SM00388
SMART:
SM00448
SMART:
SM00073
SMR:
P30855
UNIPROT:
P30855


Operon      
Name: evgAS         
Operon arrangement:
Transcription unit        Promoter
evgAS
evgAS


Transcriptional Regulation      
Display Regulation             
Activated by: EvgA
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2669 2485186 forward nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bock A., Gross R., 2002, The unorthodox histidine kinases BvgS and EvgS are responsive to the oxidation status of a quinone electron carrier., Eur J Biochem 269(14):3479-84

 [2] Eguchi Y., Oshima T., Mori H., Aono R., Yamamoto K., Ishihama A., Utsumi R., 2003, Transcriptional regulation of drug efflux genes by EvgAS, a two-component system in Escherichia coli., Microbiology 149(Pt 10):2819-28

 [3] Kinoshita-Kikuta E., Kinoshita E., Eguchi Y., Koike T., 2016, Validation of Cis and Trans Modes in Multistep Phosphotransfer Signaling of Bacterial Tripartite Sensor Kinases by Using Phos-Tag SDS-PAGE., PLoS One 11(2):e0148294

 [4] Perraud AL., Kimmel B., Weiss V., Gross R., 1998, Specificity of the BvgAS and EvgAS phosphorelay is mediated by the C-terminal HPt domains of the sensor proteins., Mol Microbiol 27(5):875-87

 [5] Sen H., Aggarwal N., Ishionwu C., Hussain N., Parmar C., Jamshad M., Bavro VN., Lund PA., 2017, Structural and Functional Analysis of the Escherichia coli Acid-Sensing Histidine Kinase EvgS., J Bacteriol 199(18)

 [6] Tanabe H., Masuda T., Yamasaki K., Katoh A., Yoshioka S., Utsumi R., 1998, Molecular interaction between proteins involved in EvgAS signal transduction of Escherichia coli., Biosci Biotechnol Biochem 62(1):78-82

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB