RegulonDB RegulonDB 10.6.3: Gene Form
   

basR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eptA adiC basS basR pmrR basSp4 basSp4 TSS_4921 TSS_4921 TSS_4920 TSS_4920 TSS_4919 TSS_4919

Gene      
Name: basR    Texpresso search in the literature
Synonym(s): ECK4106, EG11615, b4113, pmrA
Genome position(nucleotides): 4333282 <-- 4333950 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.21
External database links:  
ASAP:
ABE-0013466
CGSC:
28168
ECHOBASE:
EB1572
ECOCYC:
EG11615
ECOLIHUB:
basR
OU-MICROARRAY:
b4113
REGULONDB:
b4113
STRING:
511145.b4113
M3D: basR
COLOMBOS: basR
PortEco: b4113


Product      
Name: DNA-binding transcriptional dual regulator BasR
Synonym(s): BasR, BasR response regulator, PmrA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 25.031
Isoelectric point: 5.893
Motif(s):
 
Type Positions Sequence
124 -> 218 ESELIVGNLTLNMGRRQVWMGGEELILTPKEYALLSRLMLKAGSPVHREILYNDIYNWDNEPSTNTLEVHIHNLRDKVGKARIRTVRGFGYMLVA
128 -> 128 I
29 -> 29 S
31 -> 31 T
129 -> 129 V

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0046677 - response to antibiotic
GO:0000160 - phosphorelay signal transduction system
GO:0010041 - response to iron(III) ion
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IDA] Inferred from direct assay
Reference(s): [1] Fu W., et al., 2007
[2] Gibbons HS., et al., 2005
[3] Groisman EA. 2001
[4] Nummila K., et al., 1995
[5] Pao GM., et al., 1995
[6] Parkinson JS. 1993
[7] Parkinson JS., et al., 1992
[8] Perez-Rueda E., et al., 2004
[9] Stock JB., et al., 1990
[10] Winfield MD., et al., 2004
[11] Yamamoto K., et al., 2005
[12] Zhou Z., et al., 1999
External database links:  
DIP:
DIP-9201N
ECOCYC:
BASR-MONOMER
ECOLIWIKI:
b4113
INTERPRO:
IPR016032
INTERPRO:
IPR039420
INTERPRO:
IPR036388
INTERPRO:
IPR011006
INTERPRO:
IPR001867
INTERPRO:
IPR001789
MODBASE:
P30843
PANTHER:
PTHR26402
PFAM:
PF00072
PFAM:
PF00486
PRIDE:
P30843
PRODB:
PRO_000022199
PROSITE:
PS50110
PROSITE:
PS51755
PROTEINMODELPORTAL:
P30843
REFSEQ:
NP_418537
SMART:
SM00448
SMART:
SM00862
SMR:
P30843
UNIPROT:
P30843


Operon      
Name: basRS         
Operon arrangement:
Transcription unit        Promoter
basRS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4919 4332618 reverse nd [RS-EPT-CBR] [13]
  promoter TSS_4920 4332748 reverse nd [RS-EPT-CBR] [13]
  promoter TSS_4921 4332753 reverse nd [RS-EPT-CBR] [13]
  promoter basSp4 4333477 reverse Similarity to the consensus
Read more >
[ICWHO] [14]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Fu W., Yang F., Kang X., Zhang X., Li Y., Xia B., Jin C., 2007, First structure of the polymyxin resistance proteins., Biochem Biophys Res Commun 361(4):1033-7

 [2] Gibbons HS., Kalb SR., Cotter RJ., Raetz CR., 2005, Role of Mg2+ and pH in the modification of Salmonella lipid A after endocytosis by macrophage tumour cells., Mol Microbiol 55(2):425-40

 [3] Groisman EA., 2001, The pleiotropic two-component regulatory system PhoP-PhoQ., J Bacteriol 183(6):1835-42

 [4] Nummila K., Kilpelainen I., Zahringer U., Vaara M., Helander IM., 1995, Lipopolysaccharides of polymyxin B-resistant mutants of Escherichia coli are extensively substituted by 2-aminoethyl pyrophosphate and contain aminoarabinose in lipid A., Mol Microbiol 16(2):271-8

 [5] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [6] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [7] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [8] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [9] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [10] Winfield MD., Groisman EA., 2004, Phenotypic differences between Salmonella and Escherichia coli resulting from the disparate regulation of homologous genes., Proc Natl Acad Sci U S A 101(49):17162-7

 [11] Yamamoto K., Hirao K., Oshima T., Aiba H., Utsumi R., Ishihama A., 2005, Functional characterization in vitro of all two-component signal transduction systems from Escherichia coli., J Biol Chem 280(2):1448-56

 [12] Zhou Z., Lin S., Cotter RJ., Raetz CR., 1999, Lipid A modifications characteristic of Salmonella typhimurium are induced by NH4VO3 in Escherichia coli K12. Detection of 4-amino-4-deoxy-L-arabinose, phosphoethanolamine and palmitate., J Biol Chem 274(26):18503-14

 [13] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [14] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB