RegulonDB RegulonDB 10.8: Gene Form
   

baeS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdtC mdtD baeS baeR yegP TSS_2404 TSS_2404

Gene      
Name: baeS    Texpresso search in the literature
Synonym(s): ECK2074, EG11617, b2078
Genome position(nucleotides): 2162876 --> 2164279 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.7
External database links:  
ASAP:
ABE-0006882
CGSC:
30761
ECHOBASE:
EB1574
OU-MICROARRAY:
b2078
PortEco:
baeS
STRING:
511145.b2078
COLOMBOS: baeS


Product      
Name: sensor histidine kinase BaeS
Synonym(s): BaeS
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 51.991
Isoelectric point: 7.79
Motif(s):
 
Type Positions Sequence
150 -> 150 R
192 -> 192 P
12 -> 32 LFLAIFATCIVLLISMHWAVR
247 -> 461 DISHELRTPLAVLRGELEAIQDGVRKFTPETVASLQAEVGTLTKLVDDLHQLSMSDEGALAYQKAPVDLIPLLEVAGGAFRERFASRGLKLQFSLPDSITVFGDRDRLMQLFNNLLENSLRYTDSGGSLQISAGQRDKTVRLTFADSAPGVSDDQLQKLFERFYRTEGSRNRASGGSGLGLAICLNIVEAHNGRIIAAHSPFGGVSITVELPLER
416 -> 416 R

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
GO:0036460 - cellular response to cell envelope stress
Note(s): Note(s): ...[more].
Reference(s): [1] Hirakawa H., et al., 2003
[2] Oshima T., et al., 2002
External database links:  
DIP:
DIP-9199N
ECOCYC:
BAES-MONOMER
ECOLIWIKI:
b2078
INTERPRO:
IPR005467
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR004358
INTERPRO:
IPR003661
INTERPRO:
IPR003660
INTERPRO:
IPR003594
MODBASE:
P30847
PFAM:
PF00672
PFAM:
PF02518
PFAM:
PF00512
PRIDE:
P30847
PRINTS:
PR00344
PRODB:
PRO_000022197
PROSITE:
PS50885
PROSITE:
PS50109
REFSEQ:
NP_416582
SMART:
SM00304
SMART:
SM00388
SMART:
SM00387
SMR:
P30847
UNIPROT:
P30847


Operon      
Name: mdtABCD-baeSR         
Operon arrangement:
Transcription unit        Promoter
mdtABCD-baeSR
baeSR


Transcriptional Regulation      
Display Regulation             
Activated by: BaeR, CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2404 2164246 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hirakawa H., Nishino K., Hirata T., Yamaguchi A., 2003, Comprehensive studies of drug resistance mediated by overexpression of response regulators of two-component signal transduction systems in Escherichia coli., J Bacteriol 185(6):1851-6

 [2] Oshima T., Aiba H., Masuda Y., Kanaya S., Sugiura M., Wanner BL., Mori H., Mizuno T., 2002, Transcriptome analysis of all two-component regulatory system mutants of Escherichia coli K-12., Mol Microbiol 46(1):281-91

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB