RegulonDB RegulonDB 10.8: Gene Form
   

artP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

artI artP ybjP ArgR ArgR artPp3 artPp3 artPp2 artPp2 artPp1 artPp1 artPp artPp TSS_1016 TSS_1016 TSS_1015 TSS_1015 TSS_1014 TSS_1014 TSS_1013 TSS_1013 TSS_1012 TSS_1012 TSS_1011 TSS_1011 TSS_1010 TSS_1010 TSS_1009 TSS_1009 TSS_1008 TSS_1008 TSS_1007 (cluster) TSS_1007 (cluster) TSS_1006 TSS_1006

Gene      
Name: artP    Texpresso search in the literature
Synonym(s): ECK0855, EG11624, b0864
Genome position(nucleotides): 903006 <-- 903734 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.67
External database links:  
ASAP:
ABE-0002939
CGSC:
31677
ECHOBASE:
EB1581
OU-MICROARRAY:
b0864
PortEco:
artP
STRING:
511145.b0864
COLOMBOS: artP


Product      
Name: L-arginine ABC transporter ATP binding subunit
Synonym(s): ArtP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 27.022
Isoelectric point: 6.62
Motif(s):
 
Type Positions Sequence
94 -> 95 WP
121 -> 121 R
3 -> 241 IQLNGINCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFDFTKTPSDKAIRDLRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALARAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAETNITQVIVTHEVEVARKTASRVVYMENGHIVEQGDASCFTEPQTEAFKNYLS
35 -> 42 GPSGAGKS
20 -> 170 DITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFDFTKTPSDKAIRDLRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALARAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0015426 - ATPase-coupled polar amino acid-transporter activity
biological_process GO:0097638 - L-arginine import across plasma membrane
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47917N
ECOCYC:
ARTP-MONOMER
ECOLIWIKI:
b0864
INTERPRO:
IPR027417
INTERPRO:
IPR030679
INTERPRO:
IPR017871
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MINT:
MINT-1236053
MODBASE:
P0AAF6
PFAM:
PF00005
PRIDE:
P0AAF6
PRODB:
PRO_000022159
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_415385
SMART:
SM00382
SMR:
P0AAF6
SWISSMODEL:
P0AAF6
UNIPROT:
P0AAF6


Operon      
Name: artPIQM         
Operon arrangement:
Transcription unit        Promoter
artPIQM
artPIQM
artPIQM
artPIQM


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1006 902897 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1007 (cluster) 903004 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1008 903017 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1009 903019 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1010 903021 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1011 903080 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1012 903084 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1013 903161 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1014 903163 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1015 903465 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1016 903534 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB