RegulonDB RegulonDB 10.8: Gene Form
   

artI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

artI artP artQ TSS_1016 TSS_1016 TSS_1015 TSS_1015 TSS_1014 TSS_1014 TSS_1013 TSS_1013 TSS_1012 TSS_1012 TSS_1011 TSS_1011 TSS_1010 TSS_1010 TSS_1009 TSS_1009 TSS_1008 TSS_1008 TSS_1007 (cluster) TSS_1007 (cluster) TSS_1006 TSS_1006 TSS_1005 (cluster) TSS_1005 (cluster) TSS_1004 TSS_1004

Gene      
Name: artI    Texpresso search in the literature
Synonym(s): ECK0854, EG11625, b0863
Genome position(nucleotides): 902257 <-- 902988 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.27
External database links:  
ASAP:
ABE-0002937
CGSC:
31674
ECHOBASE:
EB1582
OU-MICROARRAY:
b0863
PortEco:
artI
STRING:
511145.b0863
COLOMBOS: artI


Product      
Name: putative ABC transporter periplasmic binding protein ArtI
Synonym(s): ArtI
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,membrane
Molecular weight: 26.93
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
20 -> 243 AETIRFATEASYPPFESIDANNQIVGFDVDLAQALCKEIDATCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQGKYTSVDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAVVTEWLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNTALEKVKKDGTYETIYNKWFQK
23 -> 242 IRFATEASYPPFESIDANNQIVGFDVDLAQALCKEIDATCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQGKYTSVDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAVVTEWLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNTALEKVKKDGTYETIYNKWFQ
179 -> 179 T
130 -> 130 G
189 -> 190 AA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.2 - glutamine
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0015276 - ligand-gated ion channel activity
biological_process GO:0006865 - amino acid transport
GO:0034220 - ion transmembrane transport
GO:0071705 - nitrogen compound transport
Note(s): Note(s): ...[more].
Reference(s): [1] Reitzer L., et al., 2001
External database links:  
ECOCYC:
ARTI-MONOMER
ECOLIWIKI:
b0863
INTERPRO:
IPR001638
INTERPRO:
IPR001320
INTERPRO:
IPR005768
INTERPRO:
IPR018313
MODBASE:
P30859
PFAM:
PF00497
PRIDE:
P30859
PROSITE:
PS01039
REFSEQ:
NP_415384
SMART:
SM00079
SMART:
SM00062
SMR:
P30859
UNIPROT:
P30859


Operon      
Name: artPIQM         
Operon arrangement:
Transcription unit        Promoter
artPIQM
artPIQM
artPIQM
artPIQM


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1004 902050 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1005 (cluster) 902184 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1006 902897 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1007 (cluster) 903004 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1008 903017 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1009 903019 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1010 903021 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1011 903080 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1012 903084 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1013 903161 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1014 903163 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1015 903465 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1016 903534 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Reitzer L., Schneider BL., 2001, Metabolic context and possible physiological themes of sigma(54)-dependent genes in Escherichia coli., Microbiol Mol Biol Rev 65(3):422-44, table of contents

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB