RegulonDB RegulonDB 10.8: Gene Form
   

artM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

artJ artI artQ artM ArgR ArgR anti-anti-terminator anti-terminator terminator TSS_1006 TSS_1006 TSS_1005 (cluster) TSS_1005 (cluster) TSS_1004 TSS_1004 artJp artJp TSS_1002 (cluster) TSS_1002 (cluster) TSS_1001 TSS_1001

Gene      
Name: artM    Texpresso search in the literature
Synonym(s): ECK0852, EG11627, b0861
Genome position(nucleotides): 900866 <-- 901534 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.17
External database links:  
ASAP:
ABE-0002931
CGSC:
31667
ECHOBASE:
EB1584
OU-MICROARRAY:
b0861
PortEco:
artM
STRING:
511145.b0861
COLOMBOS: artM


Product      
Name: L-arginine ABC transporter membrane subunit ArtM
Synonym(s): ArtM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.914
Isoelectric point: 9.151
Motif(s):
 
Type Positions Sequence
63 -> 63 Q
32 -> 214 IFTIILTLKTPVLVWLVRGYITLFTGTPLLVQIFLIYYGPGQFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEGQWQSCSALGMSKKDTLAILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLLYGRTYDVMVFGAAGIIYLVVNGLLTLMMRLIERK
155 -> 175 VVLVFKSTSLAYTITLMEVMG
187 -> 207 VMVFGAAGIIYLVVNGLLTLM
80 -> 100 YPALWHLLSEPWLCALIALSL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0097638 - L-arginine import across plasma membrane
GO:0006865 - amino acid transport
GO:0055085 - transmembrane transport
GO:0071705 - nitrogen compound transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48169N
ECOCYC:
ARTM-MONOMER
ECOLIWIKI:
b0861
INTERPRO:
IPR010065
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P0AE30
PRODB:
PRO_000022158
PROSITE:
PS50928
REFSEQ:
NP_415382
SMR:
P0AE30
UNIPROT:
P0AE30


Operon      
Name: artPIQM         
Operon arrangement:
Transcription unit        Promoter
artPIQM
artPIQM
artPIQM
artPIQM


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1001 900345 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1002 (cluster) 900605 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1004 902050 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1005 (cluster) 902184 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1006 902897 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB