RegulonDB RegulonDB 10.7: Gene Form
   

potF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

potG potF ybjN potFp1 potFp1 potFp2 potFp2

Gene      
Name: potF    Texpresso search in the literature
Synonym(s): ECK0845, EG11629, b0854
Genome position(nucleotides): 893784 --> 894896 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.85
External database links:  
ASAP:
ABE-0002913
CGSC:
31694
ECHOBASE:
EB1586
OU-MICROARRAY:
b0854
PORTECO:
potF
REGULONDB:
b0854
STRING:
511145.b0854
M3D: potF
COLOMBOS: potF
PortEco: b0854


Product      
Name: putrescine ABC transporter periplasmic binding protein
Synonym(s): PotF
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 40.84
Isoelectric point: 6.071
Motif(s):
 
Type Positions Sequence
27 -> 370 AEQKTLHIYNWSDYIAPDTVANFEKETGIKVVYDVFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLTAGVFQPLDKSKLPEWKNLDPELLKLVAKHDPDNKFAMPYMWATTGIGYNVDKVKAVLGENAPVDSWDLILKPENLEKLKSCGVSFLDAPEEVFATVLNYLGKDPNSTKADDYTGPATDLLLKLRPNIRYFHSSQYINDLANGDICVAIGWAGDVWQASNRAKEAKNGVNVSFSIPKEGAMAFFDVFAMPADAKNKDEAYQFLNYLLRPDVVAHISDHVFYANANKAATPLVSAEVRENPGIYPPADVRAKLFTLKVQDPKIDRVRTRAWTKVKSGK
38 -> 38 S
87 -> 87 S
216 -> 217 KL
244 -> 244 W

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0019810 - putrescine binding
GO:0019808 - polyamine binding
biological_process GO:0015846 - polyamine transport
GO:0015847 - putrescine transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10531N
ECOCYC:
POTF-MONOMER
ECOLIWIKI:
b0854
INTERPRO:
IPR001188
INTERPRO:
IPR006059
MODBASE:
P31133
PANTHER:
PTHR30222:SF5
PDB:
4JDF
PDB:
1A99
PFAM:
PF13416
PRIDE:
P31133
PRINTS:
PR00909
PRODB:
PRO_000023572
PROTEINMODELPORTAL:
P31133
REFSEQ:
NP_415375
SMR:
P31133
UNIPROT:
P31133


Operon      
Name: potFGHI         
Operon arrangement:
Transcription unit        Promoter
potFGHI
potFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB