RegulonDB RegulonDB 10.8: Gene Form
   

potG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

potG potF potH potI

Gene      
Name: potG    Texpresso search in the literature
Synonym(s): ECK0846, EG11630, b0855
Genome position(nucleotides): 894991 --> 896124 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.2
External database links:  
ASAP:
ABE-0002915
CGSC:
31697
ECHOBASE:
EB1587
OU-MICROARRAY:
b0855
PortEco:
potG
STRING:
511145.b0855
COLOMBOS: potG


Product      
Name: putrescine ABC transporter ATP binding subunit
Synonym(s): PotG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 41.931
Isoelectric point: 6.956
Motif(s):
 
Type Positions Sequence
36 -> 177 DDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPM
52 -> 59 GASGCGKS
150 -> 153 LSGG
171 -> 176 LLLDEP
295 -> 375 VALRPEKIMLCEEPPANGCNFAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTWGDEVRLCWEVDSCVVL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015417 - ATPase-coupled polyamine transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0015846 - polyamine transport
GO:0055085 - transmembrane transport
GO:0015847 - putrescine transport
GO:1902047 - polyamine transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10532N
ECOCYC:
POTG-MONOMER
ECOLIWIKI:
b0855
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003439
INTERPRO:
IPR005893
INTERPRO:
IPR008995
INTERPRO:
IPR013611
MODBASE:
P31134
PFAM:
PF00005
PFAM:
PF08402
PRIDE:
P31134
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_415376
SMART:
SM00382
SMR:
P31134
UNIPROT:
P31134


Operon      
Name: potFGHI         
Operon arrangement:
Transcription unit        Promoter
potFGHI
potFGHI


Transcriptional Regulation      
Display Regulation             
Activated by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB