RegulonDB RegulonDB 10.7: Gene Form
   

nohA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

stfQ tfaQ nohA ynfO Fur Fur ynfOp1 ynfOp1 nohAp nohAp tfaQp6 tfaQp6

Gene      
Name: nohA    Texpresso search in the literature
Synonym(s): ECK1541, EG11634, b1548, nohQ
Genome position(nucleotides): 1635798 <-- 1636367 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.68
External database links:  
ASAP:
ABE-0005172
ECHOBASE:
EB1590
ECOO157CYC:
Z2365
OU-MICROARRAY:
b1548
PORTECO:
nohA
REGULONDB:
b1548
STRING:
511145.b0560
M3D: nohA
COLOMBOS: nohA
PortEco: b1548


Product      
Name: Qin prophage; putative prophage DNA-packaging protein NohA
Synonym(s): NohA, NohQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.404
Isoelectric point: 5.016
Motif(s):
 
Type Positions Sequence
1 -> 164 MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIRWYAERDAEIENEKLRREVEELRQASETDLQPGTIEYERHRLTRAQADAQELKNARDSAEVVETAFCTFVLSRIAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAAA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10355N
ECOCYC:
EG11634-MONOMER
ECOLIWIKI:
b1548
ECOO157CYC:
Z2365-MONOMER
INTERPRO:
IPR009061
INTERPRO:
IPR010906
INTERPRO:
IPR036388
MINT:
MINT-1285423
MODBASE:
P31061
PFAM:
PF07471
PRIDE:
P31061
PROTEINMODELPORTAL:
P31061
REFSEQ:
NP_416066
SMR:
P31061
SWISSMODEL:
P31061
UNIPROT:
P31061


Operon      
Name: nohA-stfQ-tfaQ         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tfaQp6 1634956 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ynfOp1 1636727 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB