RegulonDB RegulonDB 10.8: Gene Form
   

nohD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tfaD nohD aaaD ylcI

Gene      
Name: nohD    Texpresso search in the literature
Synonym(s): ECK0552, EG11635, b0560, nohB
Genome position(nucleotides): 580834 --> 581379 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.56
External database links:  
ASAP:
ABE-0001915
ECHOBASE:
EB1591
OU-MICROARRAY:
b0560
PortEco:
nohB
STRING:
511145.b0560
COLOMBOS: nohD


Product      
Name: DLP12 prophage; putative DNA-packaging protein NohD
Synonym(s): NohB, NohD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.428
Isoelectric point: 4.596
Motif(s):
 
Type Positions Sequence
1 -> 164 MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEELLQASETDLQPGTIEYERHRLTRAQADAQELKNARDSAEVVETAFCTFVLSRIAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAAA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11635-MONOMER
ECOLIWIKI:
b0560
INTERPRO:
IPR009061
INTERPRO:
IPR036388
INTERPRO:
IPR010906
MODBASE:
P31062
PFAM:
PF07471
PRIDE:
P31062
PRODB:
PRO_000023397
REFSEQ:
NP_415092
SMR:
P31062
SWISSMODEL:
P31062
UNIPROT:
P31062


Operon      
Name: nohD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB