RegulonDB RegulonDB 10.8: Gene Form
   

dgcZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcZ ydeI mgrR mgtT FNR CysB CpxR PhoP dgcZp dgcZp TSS_1844 TSS_1844 mgrRp mgrRp

Gene      
Name: dgcZ    Texpresso search in the literature
Synonym(s): ECK1528, EG11643, b1535, ydeG, ydeH
Genome position(nucleotides): 1622960 <-- 1623850 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.89
External database links:  
ASAP:
ABE-0005123
ECHOBASE:
EB1596
OU-MICROARRAY:
b1535
PortEco:
ydeH
STRING:
511145.b1535
COLOMBOS: dgcZ


Product      
Name: diguanylate cyclase DgcZ
Synonym(s): DgcZ, YdeG, YdeH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 33.863
Isoelectric point: 5.499
Motif(s):
 
Type Positions Sequence
83 -> 83 H
130 -> 283 NMDVLTGLPGRRVLDESFDHQLRNAEPLNLYLMLLDIDRFKLVNDTYGHLIGDVVLRTLATYLASWTRDYETVYRYGGEEFIIIVKAANDEEACRAGVRICQLVDNHAITHSEGHINITVTAGVSRAFPEEPLDVVIGRADRAMYEGKQTGRNR
195 -> 200 WTRDYE
79 -> 79 H
206 -> 207 GG

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005886 - plasma membrane
GO:0060187 - cell pole
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0008270 - zinc ion binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0052621 - diguanylate cyclase activity
biological_process GO:0008152 - metabolic process
GO:0051271 - negative regulation of cellular component movement
GO:0043709 - cell adhesion involved in single-species biofilm formation
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
GO:1902209 - negative regulation of bacterial-type flagellum assembly
GO:1900233 - positive regulation of single-species biofilm formation on inanimate substrate
External database links:  
DIP:
DIP-11677N
ECOCYC:
EG11643-MONOMER
ECOLIWIKI:
b1535
INTERPRO:
IPR000160
INTERPRO:
IPR029787
PDB:
3T9O
PDB:
3TVK
PDB:
4H54
PFAM:
PF00990
PRIDE:
P31129
PROSITE:
PS50887
REFSEQ:
NP_416052
SMART:
SM00267
SMR:
P31129
UNIPROT:
P31129


Operon      
Name: dgcZ         
Operon arrangement:
Transcription unit        Promoter
dgcZ


Transcriptional Regulation      
Display Regulation             
Activated by: CysB, CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1844 1623877 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB