RegulonDB RegulonDB 10.8: Gene Form
   

ydeJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcp ydeJ ydeI FNR TSS_1847 TSS_1847 TSS_1846 TSS_1846 ydeJp ydeJp ydeIp5 ydeIp5 ydeIp6 ydeIp6 ydeIp1 ydeIp1

Gene      
Name: ydeJ    Texpresso search in the literature
Synonym(s): ECK1530, EG11645, b1537
Genome position(nucleotides): 1624773 --> 1625291 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.33
External database links:  
ASAP:
ABE-0005131
ECHOBASE:
EB1598
OU-MICROARRAY:
b1537
PortEco:
ydeJ
STRING:
511145.b1537
COLOMBOS: ydeJ


Product      
Name: PF02464 family protein YdeJ
Synonym(s): YdeJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.321
Isoelectric point: 4.495
Motif(s):
 
Type Positions Sequence
18 -> 171 ENLTSALSQRLIADQLRLTTAESCTGGKLASALCAAEDTPKFYGAGFVTFTDQAKMKILSVSQQSLERYSAVSEKVAAEMATGAIERADADVSIAITGYGGPEGGEDGTPAGTVWFAWHIKGQNYTAVMHFAGDCETVLALAVRFALAQLLQLL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11645-MONOMER
ECOLIWIKI:
b1537
INTERPRO:
IPR036653
INTERPRO:
IPR008136
PFAM:
PF02464
PRIDE:
P31131
REFSEQ:
NP_416055
SMR:
P31131
SWISSMODEL:
P31131
UNIPROT:
P31131


Operon      
Name: ydeJ         
Operon arrangement:
Transcription unit        Promoter
ydeJ


Transcriptional Regulation      
Display Regulation             
Activated by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydeIp1 1624516 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydeIp6 1624543 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1846 1625884 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1847 1626295 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB