RegulonDB RegulonDB 10.8: Gene Form
   

accA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaE ldcC accA FadR terminator TSS_391 TSS_391 TSS_390 TSS_390 TSS_389 TSS_389 TSS_388 TSS_388 accAp accAp accAp2 accAp2 TSS_386 TSS_386 TSS_385 TSS_385 TSS_384 TSS_384 TSS_383 TSS_383 TSS_382 TSS_382

Gene      
Name: accA    Texpresso search in the literature
Synonym(s): ECK0184, EG11647, b0185
Genome position(nucleotides): 208621 --> 209580 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.29
External database links:  
ASAP:
ABE-0000630
CGSC:
29829
ECHOBASE:
EB1600
OU-MICROARRAY:
b0185
PortEco:
accA
STRING:
511145.b0185
COLOMBOS: accA


Product      
Name: acetyl-CoA carboxyltransferase subunit α
Synonym(s): AccA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.242
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
35 -> 296 NIDEEVHRLREKSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLADLAD
5 -> 151 FLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAE
2 -> 319 SLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009317 - acetyl-CoA carboxylase complex
GO:0009329 - acetate CoA-transferase complex
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0003989 - acetyl-CoA carboxylase activity
GO:0016743 - carboxyl- or carbamoyltransferase activity
GO:0042802 - identical protein binding
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0006633 - fatty acid biosynthetic process
GO:0042759 - long-chain fatty acid biosynthetic process
GO:2001295 - malonyl-CoA biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35897N
ECOCYC:
CARBOXYL-TRANSFERASE-ALPHA-MONOMER
ECOLIWIKI:
b0185
INTERPRO:
IPR011763
INTERPRO:
IPR029045
INTERPRO:
IPR001095
MINT:
P0ABD5
PANTHER:
PTHR42853
PDB:
2F9Y
PFAM:
PF03255
PRIDE:
P0ABD5
PRINTS:
PR01069
PRODB:
PRO_000022032
PROSITE:
PS50989
REFSEQ:
NP_414727
SMR:
P0ABD5
UNIPROT:
P0ABD5


Operon      
Name: accA         
Operon arrangement:
Transcription unit        Promoter
accA
accA


Transcriptional Regulation      
Display Regulation             
Activated by: FadR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_382 206909 forward nd [RS-EPT-CBR] [1]
  promoter TSS_383 207634 forward nd [RS-EPT-CBR] [1]
  promoter TSS_384 207925 forward nd [RS-EPT-CBR] [1]
  promoter TSS_385 208042 forward nd [RS-EPT-CBR] [1]
  promoter TSS_386 208276 forward nd [RS-EPT-CBR] [1]
  promoter TSS_388 208850 forward nd [RS-EPT-CBR] [1]
  promoter TSS_389 209002 forward nd [RS-EPT-CBR] [1]
  promoter TSS_390 209273 forward nd [RS-EPT-CBR] [1]
  promoter TSS_391 209658 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB