RegulonDB RegulonDB 10.8: Gene Form
   

dkgB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yafC dkgB yafD aspU NsrR NsrR terminator anti-terminator anti-anti-terminator TSS_428 TSS_428 TSS_427 TSS_427 TSS_426 TSS_426 TSS_425 TSS_425 yafCp6 yafCp6 yafDp yafDp TSS_424 TSS_424 TSS_423 TSS_423 TSS_422 TSS_422 dkgBp dkgBp TSS_421 TSS_421

Gene      
Name: dkgB    Texpresso search in the literature
Synonym(s): ECK0207, EG11648, b0207, yafB
Genome position(nucleotides): 229167 --> 229970 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.27
External database links:  
ASAP:
ABE-0000692
ECHOBASE:
EB1601
OU-MICROARRAY:
b0207
PortEco:
dkgB
STRING:
511145.b0207
COLOMBOS: dkgB


Product      
Name: methylglyoxal reductase DkgB
Synonym(s): AKR3F2, DkgB, YafB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.437
Isoelectric point: 5.41
Motif(s):
 
Type Positions Sequence
179 -> 231 MTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSSTKRKNLESN
194 -> 195 RI
10 -> 185 TFRLKDDVVISSVITALELGYRAIDTAQIYDNEAAVGQAIAESGVPRHELYITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSPNDEVSVEEFMQALLEAKKQGLTREIGISNFTIPLMEKAIAAVGAENIATNQIELSPYLQNRKVVAWAKQHGIHITSYMTLAYGK
187 -> 250 LKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSSTKRKNLESNLKAQNLQLDAEDKKAIAAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.23 - methylglyoxal metabolism
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0004033 - aldo-keto reductase (NADP) activity
GO:0047681 - aryl-alcohol dehydrogenase (NADP+) activity
GO:1990002 - methylglyoxal reductase (NADPH-dependent, acetol producing)
biological_process GO:0051596 - methylglyoxal catabolic process
GO:0019853 - L-ascorbic acid biosynthetic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-149
ECOLIWIKI:
b0207
INTERPRO:
IPR020471
INTERPRO:
IPR018170
INTERPRO:
IPR023210
INTERPRO:
IPR036812
MODBASE:
P30863
PANTHER:
PTHR43827
PFAM:
PF00248
PRIDE:
P30863
PRINTS:
PR00069
PRODB:
PRO_000022452
PROSITE:
PS00798
PROSITE:
PS00062
REFSEQ:
NP_414743
SMR:
P30863
UNIPROT:
P30863


Operon      
Name: dkgB         
Operon arrangement:
Transcription unit        Promoter
dkgB


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_421 228928 forward nd [RS-EPT-CBR] [1]
  promoter TSS_422 230910 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_423 230912 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_424 230918 reverse nd [RS-EPT-CBR] [1]
  promoter yafCp6 231083 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_425 231274 forward nd [RS-EPT-CBR] [1]
  promoter TSS_426 231276 forward nd [RS-EPT-CBR] [1]
  promoter TSS_427 231280 forward nd [RS-EPT-CBR] [1]
  promoter TSS_428 231299 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB