RegulonDB RegulonDB 10.9: Gene Form
   

degS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

degQ degS mdh TSS_3568 (cluster) TSS_3568 (cluster) degSp degSp

Gene      
Name: degS    Texpresso search in the literature
Synonym(s): ECK3224, EG11652, b3235, hhoB, htrH
Genome position(nucleotides): 3382200 --> 3383267 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.72
External database links:  
ASAP:
ABE-0010611
CGSC:
36678
ECHOBASE:
EB1605
ECOLIHUB:
degS
OU-MICROARRAY:
b3235
STRING:
511145.b3235
COLOMBOS: degS


Product      
Name: serine endoprotease
Synonym(s): DegS, HhoB, HtrH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 37.581
Isoelectric point: 5.347
Motif(s):
 
Type Positions Sequence
177 -> 189 GRIGLNPTGRQNF
218 -> 230 LSFDKSNDGETPE
253 -> 253 R
281 -> 326 GIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMDQVAEIR
319 -> 319 M

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.4 - proteases, cleavage of compounds
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0031226 - intrinsic component of plasma membrane
GO:0016021 - integral component of membrane
GO:0071575 - integral component of external side of plasma membrane
molecular_function GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0004252 - serine-type endopeptidase activity
GO:0008236 - serine-type peptidase activity
GO:0042802 - identical protein binding
biological_process GO:0006508 - proteolysis
GO:0071218 - cellular response to misfolded protein
External database links:  
DIP:
DIP-39580N
ECOCYC:
EG11652-MONOMER
ECOLIWIKI:
b3235
INTERPRO:
IPR001478
INTERPRO:
IPR043504
INTERPRO:
IPR001940
INTERPRO:
IPR009003
INTERPRO:
IPR011783
INTERPRO:
IPR036034
MODBASE:
P0AEE3
PDB:
3GCN
PDB:
3GCO
PDB:
3GDS
PDB:
3GDU
PDB:
3GDV
PDB:
3LGI
PDB:
3LGT
PDB:
3LGU
PDB:
3LGV
PDB:
3LGW
PDB:
3LGY
PDB:
3LH1
PDB:
3LH3
PDB:
4RQY
PDB:
4RQZ
PDB:
4RR0
PDB:
4RR1
PDB:
6EW9
PDB:
3B8J
PDB:
2RCE
PDB:
2R3Y
PDB:
2R3U
PDB:
2QGR
PDB:
2QF3
PDB:
2QF0
PDB:
1VCW
PDB:
1TE0
PDB:
1SOZ
PDB:
1SOT
PFAM:
PF13365
PFAM:
PF13180
PRIDE:
P0AEE3
PRINTS:
PR00834
PRODB:
PRO_000022427
PROSITE:
PS50106
REFSEQ:
NP_417702
SMART:
SM00228
SMR:
P0AEE3
SWISSMODEL:
P0AEE3
UNIPROT:
P0AEE3


Operon      
Name: degQS         
Operon arrangement:
Transcription unit        Promoter
degQS
degQ
degS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3568 (cluster) 3382929 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB