RegulonDB RegulonDB 10.0: Gene Form
   

atoB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

atoE atoB yfaP atoA

Gene      
Name: atoB    Texpresso search in the literature
Synonym(s): ECK2217, EG11672, b2224
Genome position(nucleotides): 2326109 --> 2327293 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.0
External database links:  
ASAP:
ABE-0007355
CGSC:
985
ECHOBASE:
EB1623
ECOGENE:
EG11672
ECOLIHUB:
atoB
OU-MICROARRAY:
b2224
STRING:
511145.b2224
M3D: atoB
COLOMBOS: atoB
PortEco: b2224


Product      
Name: acetyl-CoA acetyltransferase
Synonym(s): AtoB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.352
Isoelectric point: 7.102
Motif(s):
 
Type Positions Sequence
270 -> 392 LTPLARIKSYASGGVPPALMGMGPVPATQKALQLAGLQLADIDLIEANEAFAAQFLAVGKNLGFDSEKVNVNGGAIALGHPIGASGARILVTLLHAMQARDKTLGLATLCIGGGQGIAMVIER
4 -> 263 CVIVSAVRTAIGSFNGSLASTSAIDLGATVIKAAIERAKIDSQHVDEVIMGNVLQAGLGQNPARQALLKSGLAETVCGFTVNKVCGSGLKSVALAAQAIQAGQAQSIVAGGMENMSLAPYLLDAKARSGYRLGDGQVYDVILRDGLMCATHGYHMGITAENVAKEYGITREMQDELALHSQRKAAAAIESGAFTAEIVPVNVVTRKKTFVFSQDEFPKANSTAEALGALRPAFDKAGTVTAGNASGINDGAAALVIMEES

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0003985 - acetyl-CoA C-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
GO:0003988 - acetyl-CoA C-acyltransferase activity
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0006635 - fatty acid beta-oxidation
GO:0051289 - protein homotetramerization
GO:0043442 - acetoacetic acid catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
ACETYL-COA-ACETYLTRANSFER-MONOMER
ECOLIWIKI:
b2224
ENZYME-DB:
2.3.1.9
INTERPRO:
IPR016039
INTERPRO:
IPR002155
INTERPRO:
IPR020610
INTERPRO:
IPR020613
INTERPRO:
IPR020615
INTERPRO:
IPR020616
INTERPRO:
IPR020617
MODBASE:
P76461
PANTHER:
PTHR18919
PDB:
5F38
PDB:
5F0V
PDB:
4WYS
PFAM:
PF02803
PFAM:
PF00108
PRIDE:
P76461
PRODB:
PRO_000022181
PROSITE:
PS00098
PROSITE:
PS00099
PROSITE:
PS00737
PROTEINMODELPORTAL:
P76461
REFSEQ:
NP_416728
SMR:
P76461
SWISSMODEL:
P76461
UNIPROT:
P76461


Operon      
Name: atoDAEB         
Operon arrangement:
Transcription unit        Promoter
atoDAEB


Transcriptional Regulation      
Display Regulation             
Note: The TF binding sites with unknown position are not displayed in the graphic.
Activated by: AtoC, IHF



RegulonDB