RegulonDB RegulonDB 10.7: Gene Form
   

yadC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yadC panB yadK panBp panBp TSS_272 TSS_272 panCp2 panCp2 panCp4 panCp4

Gene      
Name: yadC    Texpresso search in the literature
Synonym(s): ECK0134, EG11678, b0135
Genome position(nucleotides): 149715 <-- 150953 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.36
External database links:  
ASAP:
ABE-0000470
ECHOBASE:
EB1629
OU-MICROARRAY:
b0135
PORTECO:
yadC
REGULONDB:
b0135
STRING:
511145.b0135
M3D: yadC
COLOMBOS: yadC
PortEco: b0135


Product      
Name: fimbrial tip-adhesin YadC
Synonym(s): YadC
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 44.899
Isoelectric point: 5.652
Motif(s):
 
Type Positions Sequence
226 -> 245 SPGTKVVDHSNHIYVNFTLN
210 -> 211 VQ
250 -> 411 TLPTCFTSILTGPSVNGSTVRMGEYSSGTIKNGASPVPFDISLQNCIRVRNIETKLVTGKVGTQNTQLLGNTLTGSTAAKGVGVLIEGLATSKNPLMTLKPNDTNSVYIDYETEDDTSDGVYPNQGNGTSQPLHFQATLKQDGNIAIEPGEFKATSTFQVTY
276 -> 280 SGTIK
353 -> 353 T

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0007155 - cell adhesion
GO:0046677 - response to antibiotic
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Larsonneur F., et al., 2016
[4] Wurpel DJ., et al., 2013
External database links:  
DIP:
DIP-11181N
ECOCYC:
EG11678-MONOMER
ECOLIWIKI:
b0135
INTERPRO:
IPR036937
INTERPRO:
IPR008966
INTERPRO:
IPR000259
INTERPRO:
IPR017014
MODBASE:
P31058
PFAM:
PF00419
PRIDE:
P31058
PROTEINMODELPORTAL:
P31058
REFSEQ:
NP_414677
SMR:
P31058
UNIPROT:
P31058


Operon      
Name: yadMLKC         
Operon arrangement:
Transcription unit        Promoter
yadC
yadMLKC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter panCp4 148910 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter panCp2 148920 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_272 149617 reverse nd [RS-EPT-CBR] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Larsonneur F., Martin FA., Mallet A., Martinez-Gil M., Semetey V., Ghigo JM., Beloin C., 2016, Functional analysis of Escherichia coli Yad fimbriae reveals their potential role in environmental persistence., Environ Microbiol 18(12):5228-5248

 [4] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB