RegulonDB RegulonDB 10.8: Gene Form
   

adeD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

adeD uhpT adeQ uhpT3\' yicOp1 yicOp1 adep7 adep7 yicOp10 yicOp10 adep adep adep6 adep6 yicOp5 yicOp5 yicOp11 yicOp11 yicNp4 yicNp4

Gene      
Name: adeD    Texpresso search in the literature
Synonym(s): ECK3656, EG11692, ade, adeC(B.s.), adu, b3665, yicP
Genome position(nucleotides): 3843964 --> 3845730 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.61
External database links:  
ASAP:
ABE-0011979
ECHOBASE:
EB1643
OU-MICROARRAY:
b3665
PortEco:
ade
STRING:
511145.b3665
COLOMBOS: adeD


Product      
Name: adenine deaminase
Synonym(s): Ade, AdeD, Adu, YicP, cryptic adenine deaminase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 63.739
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
434 -> 579 RDDVSFIAVLERYGQRLAPACGLLGGFGLNEGALAATVSHDSHNIVVIGRSAEEMALAVNQVIQDGGGLCVVRNGQVQSHLPLPIAGLMSTDTAQSLAEQIDALKAAARECGPLPDEPFIQMAFLSLPVIPALKLTSQGLFDGEKF
82 -> 362 AVPGFIDAHLHIESSMMTPVTFETATLPRGLTTVICDPHEIVNVMGEAGFAWFARCAEQARQNQYLQVSSCVPALEGCDVNGASFTLEQMLAWRDHPQVTGLAEMMDYPGVISGQNALLDKLDAFRHLTLDGHCPGLGGKELNAYITAGIENCHESYQLEEGRRKLQLGMSLMIREGSAARNLNALAPLINEFNSPQCMLCTDDRNPWEIAHEGHIDALIRRLIEQHNVPLHVAYRVASWSTARHFGLNHLGLLAPGKQADIVLLSDARKVTVQQVLVKGE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016810 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
GO:0000034 - adenine deaminase activity
GO:0004096 - catalase activity
GO:0008198 - ferrous iron binding
GO:0030145 - manganese ion binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006146 - adenine catabolic process
GO:0046101 - hypoxanthine biosynthetic process
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
Reference(s): [1] Shimaoka M., et al., 2005
External database links:  
DIP:
DIP-12439N
ECOCYC:
EG11692-MONOMER
ECOLIWIKI:
b3665
INTERPRO:
IPR006679
INTERPRO:
IPR032466
INTERPRO:
IPR026912
INTERPRO:
IPR011059
INTERPRO:
IPR006680
MINT:
MINT-1285289
MODBASE:
P31441
PANTHER:
PTHR11113:SF2
PFAM:
PF13382
PFAM:
PF01979
PRIDE:
P31441
PRODB:
PRO_000022055
REFSEQ:
NP_418121
SMR:
P31441
UNIPROT:
P31441


Operon      
Name: adeD         
Operon arrangement:
Transcription unit        Promoter
ade


Transcriptional Regulation      
Display Regulation             
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yicNp4 3842509 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yicOp11 3843819 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yicOp5 3843880 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter adep6 3843901 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yicOp10 3843921 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter adep7 3843930 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yicOp1 3843957 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Shimaoka M., Kawasaki H., Takenaka Y., Kurahashi O., Matsui H., 2005, Effects of edd and pgi disruptions on inosine accumulation in Escherichia coli., Biosci Biotechnol Biochem 69(7):1248-55

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB