RegulonDB RegulonDB 9.3: Gene Form
   

gpmA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aroG galM gpmA galK Fur Fur TSS_931 TSS_931 gpmAp2 gpmAp2 gpmAp gpmAp TSS_928 TSS_928 TSS_927 TSS_927 TSS_926 TSS_926 TSS_925 (cluster) TSS_925 (cluster) TSS_924 (cluster) TSS_924 (cluster) TSS_923 TSS_923

Gene      
Name: gpmA    Texpresso search in the literature
Synonym(s): ECK0744, b0755, gpm
Genome position(nucleotides): 786843 <-- 787595 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.0
External database links:  
OU-MICROARRAY:
b0755
M3D: gpmA
COLOMBOS: gpmA
PortEco: b0755


Product      
Name: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Synonym(s): B0755, Gpm, GpmA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.556
Isoelectric point: 6.07
Motif(s):
 
Type Positions Sequence
116 -> 117 RR
185 -> 186 GN
23 -> 24 TG
2 -> 250 AVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGKAK
6 -> 125 LVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.1 - glycolysis
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
External database links:  
ECOCYC:
GPMA-MONOMER
EXPASY:
EC-5.4.2.11
GENPROTEC:
b0755
PDB:
1E59
PDB:
1E58


Operon      
Name: gpmA         
Operon arrangement:
Transcription unit        Promoter
gpmA
gpmA


Transcriptional Regulation      
Display Regulation             
Note: The TF binding sites with unknown position are not displayed in the graphic.
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_923 785768 forward nd [RS-EPT-CBR] [1]
  promoter TSS_924 (cluster) 785886 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_925 (cluster) 785890 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_926 785897 forward nd [RS-EPT-CBR] [1]
  promoter TSS_927 787626 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_928 787629 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_931 787682 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB