RegulonDB RegulonDB 9.1: Gene Form
   

gpmA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aroG galM gpmA galK Fur Fur TSS_931 TSS_931 gpmAp2 gpmAp2 gpmAp gpmAp TSS_928 TSS_928 TSS_927 TSS_927 TSS_926 TSS_926 TSS_925 (cluster) TSS_925 (cluster) TSS_924 (cluster) TSS_924 (cluster) TSS_923 TSS_923

Gene      
Name: gpmA    Texpresso search in the literature
Synonym(s): b0755, gpm
Genome position(nucleotides): 786066 <-- 786818 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.0
External database links:  
ECOCYC:
EG11699
GENBANK:
1786970
GENBANK_RefSeq:
16128723
OU-MICROARRAY:
b0755
M3D: gpmA
COLOMBOS: gpmA
PortEco: b0755


Product      
Name: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase monomer
Synonym(s): Gpm, GpmA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.556
Isoelectric point: 6.07
Motif(s):
 
Type Positions Sequence
116 -> 117 RR
185 -> 186 GN
23 -> 24 TG
2 -> 250 AVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGKAK
6 -> 125 LVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.1 - glycolysis
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016853 - isomerase activity
GO:0004619 - phosphoglycerate mutase activity
GO:0042803 - protein homodimerization activity
GO:0046538 - 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase activity
biological_process GO:0008152 - metabolic process
GO:0006096 - glycolytic process
External database links:  
ECOCYC:
GPMA-MONOMER
EXPASY:
EC-5.4.2.11
GENPROTEC:
b0755
PDB:
1E59
PDB:
1E58


Operon      
Name: gpmA         
Operon arrangement:
Transcription unit        Promoter
gpmA
gpmA


Transcriptional Regulation      
Display Regulation             
Note: The TF binding sites with unknown position are not displayed in the graphic.
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_923 784991 forward nd nd nd
  promoter TSS_924 (cluster) 785109 forward For this promoter, there
Read more >
nd nd
  promoter TSS_925 (cluster) 785113 forward For this promoter, there
Read more >
nd nd
  promoter TSS_926 785120 forward nd nd nd
  promoter TSS_927 786849 reverse nd nd nd
  promoter TSS_928 786852 reverse nd nd nd
  promoter TSS_931 786905 reverse nd nd nd



RegulonDB