RegulonDB RegulonDB 8.6: Gene Form
   

gpmA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aroG galM gpmA galK Fur Fur TSS_838 TSS_838 gpmAp2 gpmAp2 gpmAp gpmAp TSS_837 TSS_837 TSS_836 TSS_836 TSS_835 TSS_835 TSS_834 (cluster) TSS_834 (cluster) TSS_833 (cluster) TSS_833 (cluster) TSS_832 TSS_832

Gene      
Name: gpmA    Texpresso search in the literature
Synonym(s): b0755, gpm
Genome position(nucleotides): 786066 <-- 786818 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.0
External database links:  
ECOCYC:
EG11699
GENBANK:
1786970
GENBANK_RefSeq:
16128723
OU-MICROARRAY:
b0755
M3D: gpmA
COLOMBOS: gpmA
PortEco: b0755


Product      
Name: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase monomer
Synonym(s): Gpm, GpmA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.556
Isoelectric point: 6.07
Motif(s):
 
Type Positions Sequence
116 -> 117 RR
23 -> 24 TG
2 -> 250 AVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAAAVANQGKAK
89 -> 92 ERHY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.1 - glycolysis
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0003824 - catalytic activity
GO:0016853 - isomerase activity
GO:0004619 - phosphoglycerate mutase activity
GO:0042803 - protein homodimerization activity
GO:0046538 - 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase activity
biological_process GO:0008152 - metabolic process
GO:0006094 - gluconeogenesis
GO:0006096 - glycolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
GPMA-MONOMER
EXPASY:
EC-5.4.2.11
GENPROTEC:
b0755
PDB:
1E59
PDB:
1E58


Operon      
Name: gpmA         
Operon arrangement:
Transcription unit        Promoter
gpmA
gpmA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_832 784991 forward nd [RS-EPT-CBR] [1]
  promoter TSS_833 (cluster) 785109 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_834 (cluster) 785113 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_835 785120 forward nd [RS-EPT-CBR] [1]
  promoter TSS_836 786849 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_837 786852 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_838 786905 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB