RegulonDB RegulonDB 10.7: Gene Form
   

acrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

acrB acrA acrR SoxS MarA EnvR AcrR MprA PhoP anti-terminator terminator terminator anti-terminator anti-anti-terminator TSS_628 TSS_628 TSS_627 TSS_627 TSS_626 (cluster) TSS_626 (cluster) TSS_625 TSS_625 acrRp acrRp acrAp acrAp TSS_624 TSS_624 TSS_623 (cluster) TSS_623 (cluster) acrBp acrBp TSS_622 TSS_622 TSS_621 TSS_621 TSS_620 TSS_620 TSS_619 TSS_619 TSS_618 TSS_618 TSS_617 TSS_617

Gene      
Name: acrA    Texpresso search in the literature
Synonym(s): ECK0457, EG11703, Mb, b0463, lir, mbl, mtcA, nbsA, sipB
Genome position(nucleotides): 484426 <-- 485619 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.85
External database links:  
ASAP:
ABE-0001603
CGSC:
1045
ECHOBASE:
EB1654
OU-MICROARRAY:
b0463
PORTECO:
acrA
REGULONDB:
b0463
STRING:
511145.b0463
M3D: acrA
COLOMBOS: acrA
PortEco: b0463


Product      
Name: multidrug efflux pump membrane fusion lipoprotein AcrA
Synonym(s): AcrA, AcrA membrane fusion protein, Lir, Mbl, MtcA, NbsA, SipB, acridine efflux pump, periplasmic adaptor protein AcrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 42.197
Isoelectric point: 8.346
Motif(s):
 
Type Positions Sequence
130 -> 139 QKLLGTQYIS
139 -> 139 S
63 -> 293 YRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFV
223 -> 224 FL
38 -> 360 PAVGVVTVKTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVASQAIGDKWLVTEGLKAGDRVV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0031226 - intrinsic component of plasma membrane
GO:0031237 - intrinsic component of periplasmic side of plasma membrane
GO:1990281 - efflux pump complex
molecular_function GO:0015567 - alkane transmembrane transporter activity
GO:0015125 - bile acid transmembrane transporter activity
GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0042910 - xenobiotic transmembrane transporter activity
biological_process GO:0015895 - alkane transport
GO:0042493 - response to drug
GO:0009636 - response to toxic substance
GO:0046677 - response to antibiotic
GO:0006855 - drug transmembrane transport
GO:0015908 - fatty acid transport
GO:0055085 - transmembrane transport
GO:0042908 - xenobiotic transport
GO:0015721 - bile acid and bile salt transport
Note(s): Note(s): ...[more].
Reference(s): [1] Avila-Sakar AJ., et al., 2001
[2] Elkins CA., et al., 2003
[3] Ge Q., et al., 2009
[4] Hansen MT. 1982
[5] Henson JM., et al., 1982
[6] Jindal S., et al., 2019
[7] Ma D., et al., 1995
[8] Nakamura H. 1979
[9] Nakamura H. 1974
[10] Nakamura H., et al., 1985
[11] Sedgwick EG., et al., 1992
[12] Stegmeier JF., et al., 2006
[13] Wang B., et al., 2012
[14] Weeks JW., et al., 2010
External database links:  
DIP:
DIP-29039N
ECOCYC:
EG11703-MONOMER
ECOLIWIKI:
b0463
INTERPRO:
IPR006143
INTERPRO:
IPR032317
MODBASE:
P0AE06
PDB:
5V5S
PDB:
5O66
PDB:
5NG5
PDB:
2F1M
PFAM:
PF00529
PFAM:
PF16576
PRIDE:
P0AE06
PRODB:
PRO_000022048
PROSITE:
PS51257
PROTEINMODELPORTAL:
P0AE06
REFSEQ:
NP_414996
SMR:
P0AE06
SWISSMODEL:
P0AE06
UNIPROT:
P0AE06


Operon      
Name: acrAB         
Operon arrangement:
Transcription unit        Promoter
 
acrAB


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, SoxS, Rob
Repressed by: MprA, EnvR, PhoP, AcrR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_617 482380 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_618 482514 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_619 482517 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_620 482528 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_621 483377 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_622 483477 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_623 (cluster) 485648 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [15]
  promoter TSS_624 485663 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_625 485716 forward nd [RS-EPT-CBR] [15]
  promoter TSS_626 (cluster) 485980 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [15]
  promoter TSS_627 486041 reverse nd [RS-EPT-CBR] [15]
  promoter TSS_628 486086 reverse nd [RS-EPT-CBR] [15]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Avila-Sakar AJ., Misaghi S., Wilson-Kubalek EM., Downing KH., Zgurskaya H., Nikaido H., Nogales E., 2001, Lipid-layer crystallization and preliminary three-dimensional structural analysis of AcrA, the periplasmic component of a bacterial multidrug efflux pump., J Struct Biol 136(1):81-8

 [2] Elkins CA., Nikaido H., 2003, Chimeric analysis of AcrA function reveals the importance of its C-terminal domain in its interaction with the AcrB multidrug efflux pump., J Bacteriol 185(18):5349-56

 [3] Ge Q., Yamada Y., Zgurskaya H., 2009, The C-terminal domain of AcrA is essential for the assembly and function of the multidrug efflux pump AcrAB-TolC., J Bacteriol 191(13):4365-71

 [4] Hansen MT., 1982, Sensitivity of Escherichia coli acrA mutants to psoralen plus near-ultraviolet radiation., Mutat Res 106(2):209-16

 [5] Henson JM., Walker JR., 1982, Genetic analysis of acrA and lir mutations of Escherichia coli., J Bacteriol 152(3):1301-2

 [6] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [7] Ma D., Cook DN., Alberti M., Pon NG., Nikaido H., Hearst JE., 1995, Genes acrA and acrB encode a stress-induced efflux system of Escherichia coli., Mol Microbiol 16(1):45-55

 [8] Nakamura H., 1979, Specific proline accumulation in an acrA mutant of Escherichia coli K12 grown in salt-hypertonic medium., J Gen Microbiol 113(2):425-7

 [9] Nakamura H., 1974, Plasmid-instability in acrA mutants of Escherichia coli K12., J Gen Microbiol 84(1):85-93

 [10] Nakamura H., Shinya T., 1985, Acriflavine-binding capacity controlled by the acrA gene of Escherichia coli., J Gen Microbiol 131(7):1639-47

 [11] Sedgwick EG., Bragg PD., 1992, Mechanism of energization of uptake of the fluorescent dye 2-(4-dimethylaminostyryl)-1-ethylpyridinium cation [DMP+] into an acrA strain of Escherichia coli., Biochim Biophys Acta 1099(1):51-6

 [12] Stegmeier JF., Polleichtner G., Brandes N., Hotz C., Andersen C., 2006, Importance of the adaptor (membrane fusion) protein hairpin domain for the functionality of multidrug efflux pumps., Biochemistry 45(34):10303-12

 [13] Wang B., Weng J., Fan K., Wang W., 2012, Interdomain flexibility and pH-induced conformational changes of AcrA revealed by molecular dynamics simulations., J Phys Chem B 116(10):3411-20

 [14] Weeks JW., Celaya-Kolb T., Pecora S., Misra R., 2010, AcrA suppressor alterations reverse the drug hypersensitivity phenotype of a TolC mutant by inducing TolC aperture opening., Mol Microbiol 75(6):1468-83

 [15] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB