RegulonDB RegulonDB 10.6.3: Gene Form
   

yidL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yidK yidL glvG ysdC yidJ RcsB terminator yidLp yidLp

Gene      
Name: yidL    Texpresso search in the literature
Synonym(s): ECK3671, EG11707, b3680
Genome position(nucleotides): 3860283 --> 3861176 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.51
External database links:  
ASAP:
ABE-0012034
ECHOBASE:
EB1658
ECOCYC:
EG11707
ECOLIHUB:
yidL
OU-MICROARRAY:
b3680
REGULONDB:
b3680
STRING:
511145.b3680
M3D: yidL
COLOMBOS: yidL
PortEco: b3680


Product      
Name: putative DNA-binding transcriptional regulator YidL
Synonym(s): YidL, putative ARAC-type regulatory protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.958
Isoelectric point: 7.307
Motif(s):
 
Type Positions Sequence
187 -> 285 EKLIATLHASLQQRWSVADMAATIPCSEAWLRRLFLRYTGKTPKEYYLDARLDLALSLLKQQGNSVGEVADTLNFFDSFHFSKAFKHKFGYAPSAVLKN
204 -> 225 ADMAATIPCSEAWLRRLFLRYT
207 -> 284 AATIPCSEAWLRRLFLRYTGKTPKEYYLDARLDLALSLLKQQGNSVGEVADTLNFFDSFHFSKAFKHKFGYAPSAVLK
65 -> 128 VYTVQGCGKILLKNGEQITLHGNCIIFLKPMDIHSYHCEGLVWEQYWMEFTPTSMMDIPVGQQS
252 -> 275 VGEVADTLNFFDSFHFSKAFKHKF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
EG11707-MONOMER
ECOLIWIKI:
b3680
INTERPRO:
IPR018060
INTERPRO:
IPR037923
INTERPRO:
IPR018062
INTERPRO:
IPR009057
INTERPRO:
IPR003313
MODBASE:
P31449
PFAM:
PF02311
PFAM:
PF12833
PRIDE:
P31449
PROSITE:
PS01124
PROSITE:
PS00041
PROTEINMODELPORTAL:
P31449
REFSEQ:
NP_418136
SMART:
SM00342
SMR:
P31449
UNIPROT:
P31449


Operon      
Name: yidL         
Operon arrangement:
Transcription unit        Promoter
yidL


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB