RegulonDB RegulonDB 10.9: Gene Form
   

yidQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yidR ibpA yidQ CpxR CpxR CpxR IHF Cis-reg; thermoregulator terminator yidQp yidQp ibpAp ibpAp

Gene      
Name: yidQ    Texpresso search in the literature
Synonym(s): ECK3680, EG11712, b3688, ecfI
Genome position(nucleotides): 3867728 --> 3868060 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.75
External database links:  
ASAP:
ABE-0012063
ECHOBASE:
EB1663
ECOLIHUB:
yidQ
OU-MICROARRAY:
b3688
STRING:
511145.b3688
COLOMBOS: yidQ


Product      
Name: DUF1375 domain-containing putative lipoprotein YidQ
Synonym(s): EcfI, YidQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 11.826
Isoelectric point: 5.804
Motif(s):
 
Type Positions Sequence
1 -> 26 MIRNVLLAFMICSGMTLLGGCSSVMS
34 -> 76 TYPGTRASATMIGDDETNWGTKSLAILDMPFTAVMDTLLLPWD
27 -> 110 HTGGKEGTYPGTRASATMIGDDETNWGTKSLAILDMPFTAVMDTLLLPWDVFRKDSSVRSRVEKSEANAQATNAVIPPARMPDN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11712-MONOMER
ECOLIWIKI:
b3688
INTERPRO:
IPR010780
PFAM:
PF07119
PRIDE:
P0ADM4
PROSITE:
PS51257
REFSEQ:
NP_418143
UNIPROT:
P0ADM4


Operon      
Name: yidQ         
Operon arrangement:
Transcription unit        Promoter
yidQ


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB