RegulonDB RegulonDB 11.0: Gene Form
   

phoH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

efeB phoH pgaD PhoB phoHp2 phoHp2 phoHp1 phoHp1

Gene      
Name: phoH    Texpresso search in the literature
Synonym(s): ECK1010, EG11734, b1020, psiH
Genome position(nucleotides): 1084992 --> 1086056
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.21
External database links:  
ASAP:
ABE-0003458
CGSC:
31841
ECHOBASE:
EB1685
ECOLIHUB:
phoH
OU-MICROARRAY:
b1020
STRING:
511145.b1020
COLOMBOS: phoH


Shine dalgarno      
Sequence: cagtcactatGGAGATcgcggATG


Product      
Name: ATP-binding protein PhoH
Synonym(s): PhoH, PsiH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.265
Isoelectric point: 8.624
Motif(s):
 
Type Positions Sequence Comment
149 -> 353 ILARNEAQLHYLKAIESKQLIFATGEAGCGKTWISAAKAAEALIHKDVDRIIVTRPVLQADEDLGFLPGDIAEKFAPYFRPVYDVLVRRLGASFMQYCLRPEIGKVEIAPFAYMRGRTFENAVVILDEAQNVTAAQMKMFLTRLGENVTVIVNGDITQCDLPRGVCSGLSDALERFEEDEMVGIVRFGKEDCVRSALCQRTLHAY
173 -> 180 GEAGCGKT UniProt: ATP.

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.2 - regulons or multilayer component regulatory systems
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
Note(s): Note(s): ...[more].
Reference(s): [1] Kazakov AE., et al., 2003
[2] Meydan S., et al., 2019
External database links:  
ALPHAFOLD:
P0A9K1
DIP:
DIP-10499N
ECOCYC:
EG11734-MONOMER
ECOLIWIKI:
b1020
INTERPRO:
IPR027417
INTERPRO:
IPR003714
PFAM:
PF02562
PRIDE:
P0A9K1
PRODB:
PRO_000023543
REFSEQ:
NP_415539
SMR:
P0A9K1
UNIPROT:
P0A9K1


Operon      
Name: phoH         
Operon arrangement:
Transcription unit        Promoter
phoH
phoH


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Kazakov AE., Vassieva O., Gelfand MS., Osterman A., Overbeek R., 2003, Bioinformatics classification and functional analysis of PhoH homologs., In Silico Biol 3(1-2):3-15

 [2] Meydan S., Marks J., Klepacki D., Sharma V., Baranov PV., Firth AE., Margus T., Kefi A., Vazquez-Laslop N., Mankin AS., 2019, Retapamulin-Assisted Ribosome Profiling Reveals the Alternative Bacterial Proteome., Mol Cell 74(3):481-493.e6


RegulonDB