RegulonDB RegulonDB 10.8: Gene Form
   

efeB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

efeB efeO phoH PhoB phoHp2 phoHp2 phoHp1 phoHp1 efeOp1 efeOp1

Gene      
Name: efeB    Texpresso search in the literature
Synonym(s): ECK1009, EG11735, b1019, ycdB
Genome position(nucleotides): 1083376 --> 1084647 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.77
External database links:  
ASAP:
ABE-0003451
ECHOBASE:
EB1686
OU-MICROARRAY:
b1019
PortEco:
efeB
STRING:
511145.b1019
COLOMBOS: efeB


Product      
Name: heme-containing peroxidase/deferrochelatase
Synonym(s): EfeB, YcdB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol
Molecular weight: 46.754
Isoelectric point: 6.912
Motif(s):
 
Type Positions Sequence
61 -> 410 QAGILTPQQAAMMLVAFDVLASDKADLERLFRLLTQRFAFLTQGGAAPETPNPRLPPLDSGILGGYIAPDNLTITLSVGHSLFDERFGLAPQMPKKLQKMTRFPNDSLDAALCHGDVLLQICANTQDTVIHALRDIIKHTPDLLSVRWKREGFISDHAARSKGKETPINLLGFKDGTANPDSQNDKLMQKVVWVTADQQEPAWTIGGSYQAVRLIQFRVEFWDRTPLKEQQTIFGRDKQTGAPLGMQHEHDVPDYASDPEGKVIALDSHIRLANPRTAESESSLMLRRGYSYSLGVTNSGQLDMGLLFVCYQHDLEKGFLTVQKRLNGEALEEYVKPIGGGYFFALPGVK
1 -> 35 MQYKDENGVNEPSRRRLLKVIGALALAGSCPVAHA
236 -> 238 GTA
36 -> 423 QKTQSAPGTLSPDARNEKQPFYGEHQAGILTPQQAAMMLVAFDVLASDKADLERLFRLLTQRFAFLTQGGAAPETPNPRLPPLDSGILGGYIAPDNLTITLSVGHSLFDERFGLAPQMPKKLQKMTRFPNDSLDAALCHGDVLLQICANTQDTVIHALRDIIKHTPDLLSVRWKREGFISDHAARSKGKETPINLLGFKDGTANPDSQNDKLMQKVVWVTADQQEPAWTIGGSYQAVRLIQFRVEFWDRTPLKEQQTIFGRDKQTGAPLGMQHEHDVPDYASDPEGKVIALDSHIRLANPRTAESESSLMLRRGYSYSLGVTNSGQLDMGLLFVCYQHDLEKGFLTVQKRLNGEALEEYVKPIGGGYFFALPGVKDANDYFGSALLRV
334 -> 336 NPR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005829 - cytosol
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0020037 - heme binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0055114 - oxidation-reduction process
GO:0033212 - iron import into cell
GO:0098869 - cellular oxidant detoxification
Note(s): Note(s): ...[more].
Reference(s): [1] Wang L., et al., 2005
External database links:  
ECOCYC:
EG11735-MONOMER
ECOLIWIKI:
b1019
INTERPRO:
IPR006311
INTERPRO:
IPR011008
INTERPRO:
IPR006314
INTERPRO:
IPR006313
PDB:
2Y4F
PDB:
2Y4E
PDB:
2Y4D
PFAM:
PF04261
PRIDE:
P31545
PROSITE:
PS51404
PROSITE:
PS51318
REFSEQ:
NP_415538
SMR:
P31545
UNIPROT:
P31545


Operon      
Name: efeOB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter efeOp1 1082243 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Wang L., Li J., March JC., Valdes JJ., Bentley WE., 2005, luxS-dependent gene regulation in Escherichia coli K-12 revealed by genomic expression profiling., J Bacteriol 187(24):8350-60

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB