RegulonDB RegulonDB 10.8: Gene Form
   

nfrB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nfrA nfrB cusS ybcH cusR ybcHp4 ybcHp4

Gene      
Name: nfrB    Texpresso search in the literature
Synonym(s): ECK0561, EG11739, b0569
Genome position(nucleotides): 590941 <-- 593178 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.5
External database links:  
ASAP:
ABE-0001942
CGSC:
31157
ECHOBASE:
EB1690
OU-MICROARRAY:
b0569
PortEco:
nfrB
STRING:
511145.b0569
COLOMBOS: nfrB


Product      
Name: bacteriophage N4 adsorption protein
Synonym(s): NfrB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 85.319
Isoelectric point: 6.664
Motif(s):
 
Type Positions Sequence
8 -> 28 FATWLYGLKVIAITLAVIMFI
165 -> 382 FILHDAEDVISPMELRLFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKDVPVREALAGQVPSAGVGTCFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTEIFVRFPVVDEAKEREQRKFLQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFKTHKWTSSLTLNYFLWRDRKGAISNFVSFLAMLVMIQLLLLLA
362 -> 382 ISNFVSFLAMLVMIQLLLLLA
524 -> 628 MQGLISAEQLAQALAEQNGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRLENDELIVGSEDGIDPVSLAALTRKVGRKVRYVIVLRGQIVTGLRHWYARRRG
393 -> 413 FLSIFSGSAWLMTLLWLNFGL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0015627 - type II protein secretion system complex
biological_process GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Kiino DR., et al., 1989
[2] McPartland J., et al., 2009
External database links:  
DIP:
DIP-10333N
ECOCYC:
EG11739-MONOMER
ECOLIWIKI:
b0569
INTERPRO:
IPR001173
INTERPRO:
IPR037257
INTERPRO:
IPR029044
INTERPRO:
IPR007831
MINT:
MINT-1320212
PFAM:
PF13632
PFAM:
PF05157
PRIDE:
P0AFA5
PRODB:
PRO_000023376
REFSEQ:
NP_415101
SMR:
P0AFA5
UNIPROT:
P0AFA5


Operon      
Name: nfrBA         
Operon arrangement:
Transcription unit        Promoter
nfrBA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybcHp4 588070 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kiino DR., Rothman-Denes LB., 1989, Genetic analysis of bacteriophage N4 adsorption., J Bacteriol 171(9):4595-602

 [2] McPartland J., Rothman-Denes LB., 2009, The tail sheath of bacteriophage N4 interacts with the Escherichia coli receptor., J Bacteriol 191(2):525-32

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB