RegulonDB RegulonDB 10.8: Gene Form
   

nfrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nfrA nfrB cusS ybcH cusR ybcHp4 ybcHp4

Gene      
Name: nfrA    Texpresso search in the literature
Synonym(s): ECK0560, EG11740, b0568
Genome position(nucleotides): 587982 <-- 590954 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.06
External database links:  
ASAP:
ABE-0001939
CGSC:
31154
ECHOBASE:
EB1691
OU-MICROARRAY:
b0568
PortEco:
nfrA
STRING:
511145.b0568
COLOMBOS: nfrA


Product      
Name: bacteriophage N4 outer membrane receptor
Synonym(s): NfrA
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 111.308
Isoelectric point: 7.0
Motif(s):
 
Type Positions Sequence
28 -> 990 DNIGTSAEELGLSDYRHFVIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEAYRHFGHDDRARLLLEDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTLRCRSEVGQNALRLAQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNEARQQNTLSAAERRQWFDVLLAGQLDDRILALQSQGIFTDPQSYITYATALAYRGEKARLQHYLIENKPLFTTDAQEKSWLYLLSKYSANPVQALANYTVQFADNRQYVVGATLPVLLKEGQYDAAQKLLATLPANEMLEERYAVSVATRNKAEALRLARLLYQQEPANLTRLDQLTWQLMQNEQSREAADLLLQRYPFQGDARVSQTLMARLASLLESHPYLATPAKVAILSKPLPLAEQRQWQSQLPGIADNCPAIVRLLGDMSPSYDAAAWNRLAKCYRDTLPGVALYAWLQAEQRQPSAWQHRAVAYQAYQVEDYATALAAWQKISLHDMSNEDLLAAANTAQAAGNGAARDRWLQQAEKRGLGSNALYWWLHAQRYIPGQPELALNDLTRSINIAPSANAYVARATIYRQRHNVPAAVSDLRAALELEPNNSNTQAALGYALWDSGDIAQSREMLEPAHKGLPDDPALIRQLAYVNQRLDDMPATQHYARLVIDDIDNQALITPLTPEQNQQRFNFRRLHEEVGRRWTFSFDSSIGLRSGAMSTANNNVGGAAPGKSYRSYGQLEAEYRIGRNMLLEGDLLSVYSRVFADTGENGVMMPVKNPMSGTGLRWKPLRDQIFFIAVEQQLPLNGQNGASDTMLRASASFFNGGKYSDEWHPNGSGWFAQNLYLDAAQYIRQDIQAWTADYRVSWHQKVANGQTIEPYAHVQDNGYRDKGTQGAQLGGVGVRWNIWTGETHYDAWPHKVSLGVEYQHTFKAINQRNGERNNAFLTIGVHW
81 -> 114 IPLTLYLAEAYRHFGHDDRARLLLEDQLKRHPGD
809 -> 977 GVMMPVKNPMSGTGLRWKPLRDQIFFIAVEQQLPLNGQNGASDTMLRASASFFNGGKYSDEWHPNGSGWFAQNLYLDAAQYIRQDIQAWTADYRVSWHQKVANGQTIEPYAHVQDNGYRDKGTQGAQLGGVGVRWNIWTGETHYDAWPHKVSLGVEYQHTFKAINQRNG
612 -> 645 ANAYVARATIYRQRHNVPAAVSDLRAALELEPNN
1 -> 27 MKENNLNRVIGWSGLLLTSLLSTSALA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
biological_process GO:0046813 - receptor-mediated virion attachment to host cell
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
[IPI] Inferred from physical interaction
Reference(s): [1] Kiino DR., et al., 1989
[2] McPartland J., et al., 2009
External database links:  
DIP:
DIP-10332N
ECOCYC:
EG11740-MONOMER
ECOLIWIKI:
b0568
INTERPRO:
IPR025137
INTERPRO:
IPR011990
INTERPRO:
IPR013026
INTERPRO:
IPR019734
MODBASE:
P31600
PFAM:
PF13283
PRIDE:
P31600
PRODB:
PRO_000023375
PROSITE:
PS50005
PROSITE:
PS50293
REFSEQ:
NP_415100
SMART:
SM00028
SMR:
P31600
UNIPROT:
P31600


Operon      
Name: nfrBA         
Operon arrangement:
Transcription unit        Promoter
nfrBA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybcHp4 588070 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kiino DR., Rothman-Denes LB., 1989, Genetic analysis of bacteriophage N4 adsorption., J Bacteriol 171(9):4595-602

 [2] McPartland J., Rothman-Denes LB., 2009, The tail sheath of bacteriophage N4 interacts with the Escherichia coli receptor., J Bacteriol 191(2):525-32

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB