RegulonDB RegulonDB 10.6.3: Gene Form
   

envR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

acrE envR yhdU acrEp acrEp envRp14 envRp14 envRp15 envRp15 envRp9 envRp9 envRp12 envRp12 envRp13 envRp13 envRp11 envRp11

Gene      
Name: envR    Texpresso search in the literature
Synonym(s): ECK3251, EG11741, acrS, b3264, yhdK
Genome position(nucleotides): 3412803 <-- 3413465 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.19
External database links:  
ASAP:
ABE-0010712
ECHOBASE:
EB1692
ECOCYC:
EG11741
ECOLIHUB:
envR
OU-MICROARRAY:
b3264
REGULONDB:
b3264
STRING:
511145.b3264
M3D: envR
COLOMBOS: envR
PortEco: b3264


Product      
Name: DNA-binding transcriptional repressor EnvR
Synonym(s): AcrS, EnvR, YhdK
Sequence: Get amino acid sequence Fasta Format
Regulator Family: TetR/AcrR
Cellular location: cytosol
Molecular weight: 25.198
Isoelectric point: 5.944
Motif(s):
 
Type Positions Sequence
16 -> 62 LIETAIAQFAQHGVSKTTLNDIADAANVTRGAIYWHFENKTQLFNEM
33 -> 52 TLNDIADAANVTRGAIYWHF
10 -> 70 LKTRQELIETAIAQFAQHGVSKTTLNDIADAANVTRGAIYWHFENKTQLFNEMWLQQPSLR
84 -> 202 DPFQQLREKLIVGLQYIAKIPRQQALLKILYHKCEFNDEMLAEGVIREKMGFNPQTLREVLQACQQQGCVANNLDLDVVMIIIDGAFSGIVQNWLMNMAGYDLYKQAPALVDNVLRMFM

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0042493 - response to drug
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[HIFS] Human inference of function from sequence
Reference(s): [1] Hirakawa H., et al., 2008
[2] Pan W., et al., 1994
[3] Yang K., et al., 1995
External database links:  
ECOCYC:
EG11741-MONOMER
ECOLIWIKI:
b3264
INTERPRO:
IPR009057
INTERPRO:
IPR039419
INTERPRO:
IPR036271
INTERPRO:
IPR023772
INTERPRO:
IPR001647
INTERPRO:
IPR013572
MODBASE:
P0ACT2
PANTHER:
PTHR30328
PFAM:
PF00440
PFAM:
PF08361
PRIDE:
P0ACT2
PRINTS:
PR00455
PROSITE:
PS01081
PROSITE:
PS50977
PROTEINMODELPORTAL:
P0ACT2
REFSEQ:
NP_417730
SMR:
P0ACT2
UNIPROT:
P0ACT2


Operon      
Name: envR         
Operon arrangement:
Transcription unit        Promoter
envR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter envRp11 3413487 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter envRp13 3413601 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter envRp12 3413602 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter envRp9 3413607 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter envRp15 3413621 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter envRp14 3413633 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hirakawa H., Takumi-Kobayashi A., Theisen U., Hirata T., Nishino K., Yamaguchi A., 2008, AcrS/EnvR represses expression of the acrAB multidrug efflux genes in Escherichia coli., J Bacteriol 190(18):6276-9

 [2] Pan W., Spratt BG., 1994, Regulation of the permeability of the gonococcal cell envelope by the mtr system., Mol Microbiol 11(4):769-75

 [3] Yang K., Han L., Vining LC., 1995, Regulation of jadomycin B production in Streptomyces venezuelae ISP5230: involvement of a repressor gene, jadR2., J Bacteriol 177(21):6111-7

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB