RegulonDB RegulonDB 10.7: Gene Form
   

panC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpnC panC panB panCp2 panCp2 panCp4 panCp4 TSS_271 TSS_271

Gene      
Name: panC    Texpresso search in the literature
Synonym(s): ECK0132, EG11746, b0133
Genome position(nucleotides): 147944 <-- 148795 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.7
External database links:  
ASAP:
ABE-0000465
CGSC:
426
ECHOBASE:
EB1696
OU-MICROARRAY:
b0133
PORTECO:
panC
REGULONDB:
b0133
STRING:
511145.b0133
M3D: panC
COLOMBOS: panC
PortEco: b0133


Product      
Name: pantothenate synthetase
Synonym(s): PanC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.598
Isoelectric point: 6.173
Motif(s):
 
Type Positions Sequence
186 -> 189 LSSR
149 -> 152 GEKD
3 -> 277 IIETLPLLRQQIRRLRMEGKRVALVPTMGNLHDGHMKLVDEAKARADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPNGTETHTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMVADMGFDIEIVGVPIMRAKDGLALSSRNGYLTAEQRKIAPGLYKVLSSIADKLQAGERDLDEIITIAGQELNEKGFRADDIQIRDADTLLEVSETSKRAVILVAAWLGDARLIDN
30 -> 37 MGNLHDGH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.5 - Coenzyme A and its modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004592 - pantoate-beta-alanine ligase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0009058 - biosynthetic process
GO:0015940 - pantothenate biosynthetic process
GO:0033317 - pantothenate biosynthetic process from valine
Note(s): Note(s): ...[more].
Reference(s): [1] Birch RM., et al., 2003
[2] Chakrabarti KS., et al., 2006
[3] Rothmann M., et al., 2013
External database links:  
DIP:
DIP-10437N
ECOCYC:
PANTOATE-BETA-ALANINE-LIG-MONOMER
ECOLIWIKI:
b0133
INTERPRO:
IPR042176
INTERPRO:
IPR004821
INTERPRO:
IPR014729
INTERPRO:
IPR003721
MINT:
P31663
MODBASE:
P31663
PANTHER:
PTHR21299:SF1
PDB:
3GUZ
PDB:
1IHO
PFAM:
PF02569
PRIDE:
P31663
PRODB:
PRO_000023489
PROTEINMODELPORTAL:
P31663
REFSEQ:
NP_414675
SMR:
P31663
UNIPROT:
P31663


Operon      
Name: panBC         
Operon arrangement:
Transcription unit        Promoter
panBC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_271 147583 forward nd [RS-EPT-CBR] [4]
  promoter panCp4 148910 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter panCp2 148920 reverse Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Birch RM., O'Byrne C., Booth IR., Cash P., 2003, Enrichment of Escherichia coli proteins by column chromatography on reactive dye columns., Proteomics 3(5):764-76

 [2] Chakrabarti KS., Sarma SP., 2006, NMR assignment of 2H, 13C and 15N labeled amino-terminal domain of apo-pantothenate synthetase from E. coli., J Biomol NMR 36 Suppl 1:38

 [3] Rothmann M., Kang M., Villa R., Ntai I., La Clair JJ., Kelleher NL., Chapman E., Burkart MD., 2013, Metabolic perturbation of an essential pathway: evaluation of a glycine precursor of coenzyme A., J Am Chem Soc 135(16):5962-5

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB