RegulonDB RegulonDB 10.7: Gene Form
   

panD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yadE rpnC panD TSS_271 TSS_271 yadDp4 yadDp4 yadDp5 yadDp5 yadDp3 yadDp3 panDp2 panDp2 panDp panDp

Gene      
Name: panD    Texpresso search in the literature
Synonym(s): ECK0130, EG11747, b0131
Genome position(nucleotides): 146314 <-- 146694 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.49
External database links:  
ASAP:
ABE-0000459
CGSC:
425
ECHOBASE:
EB1697
OU-MICROARRAY:
b0131
PORTECO:
panD
REGULONDB:
b0131
STRING:
511145.b0131
M3D: panD
COLOMBOS: panD
PortEco: b0131


Product      
Name: aspartate 1-decarboxylase proenzyme
Synonym(s): PanD, PanD proenzyme, pi; protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.834
Isoelectric point: 6.097
Motif(s):
 
Type Positions Sequence
120 -> 121 AI
73 -> 75 GAA
25 -> 126 SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKAIPVQVA
107 -> 107 Y
1 -> 114 MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.5 - Coenzyme A and its modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0016831 - carboxy-lyase activity
GO:0004068 - aspartate 1-decarboxylase activity
biological_process GO:0006523 - alanine biosynthetic process
GO:0016540 - protein autoprocessing
GO:0015940 - pantothenate biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
ASPDECARBOX-MONOMER
ECOLIWIKI:
B0131
ECOO157CYC:
PAND-MONOMER
INTERPRO:
IPR009010
INTERPRO:
IPR003190
MODBASE:
P0A790
PANTHER:
PTHR21012
PDB:
1PYU
PDB:
3TM7
PDB:
4AOK
PDB:
4AON
PDB:
4AZD
PDB:
4CRY
PDB:
4CRZ
PDB:
4CS0
PDB:
4D7Z
PDB:
5LS7
PDB:
1PYQ
PDB:
1PT1
PDB:
1PT0
PDB:
1PQH
PDB:
1PQF
PDB:
1PQE
PDB:
1PPY
PDB:
1AW8
PFAM:
PF02261
PRIDE:
P0A790
PRODB:
PRO_000023490
PRODOM:
PD009294
PROTEINMODELPORTAL:
P0A790
REFSEQ:
NP_414673
SMR:
P0A790
UNIPROT:
P0A790


Operon      
Name: panD         
Operon arrangement:
Transcription unit        Promoter
panD
panD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yadDp3 146898 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yadDp5 146957 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yadDp4 146959 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_271 147583 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB