RegulonDB RegulonDB 10.7: Gene Form
   

yadE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yadE yadI panD terminator anti-terminator yadEp4 yadEp4 yadEp3 yadEp3

Gene      
Name: yadE    Texpresso search in the literature
Synonym(s): ECK0129, EG11749, b0130
Genome position(nucleotides): 145081 --> 146310 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.51
External database links:  
ASAP:
ABE-0000457
ECHOBASE:
EB1699
OU-MICROARRAY:
b0130
PORTECO:
yadE
REGULONDB:
b0130
STRING:
511145.b0130
M3D: yadE
COLOMBOS: yadE
PortEco: b0130


Product      
Name: putative polysaccharide deacetylase lipoprotein YadE
Synonym(s): YadE
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 46.315
Isoelectric point: 10.277
Motif(s):
 
Type Positions Sequence
1 -> 19 MYKQAVILLLMLFTASVSA
228 -> 366 NLPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFIVTSRIKRHPQKWNPKSLQFMSVSELNEIRDVFDFQSHTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAQFNPHVWYLSYPFGGFNDNAVKAANDAGFH
20 -> 409 ALPARYMQTIENAAVWAQIGDKMVTVGNIRAGQIIAVEPTAASYYAFNFGFGKGFIDKGHLEPVQGRQKVEDGLGDLNKPLSNQNLVTWKDTPVYNAPSAGSAPFGVLADNLRYPILHKLKDRLNQTWYQIRIGDRLAYISALDAQPDNGLSVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMVQLEGYVKNKINLPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFIVTSRIKRHPQKWNPKSLQFMSVSELNEIRDVFDFQSHTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAQFNPHVWYLSYPFGGFNDNAVKAANDAGFHLAVTTMKGKVKPGDNPLLLKRLYILRTDSLETMSRLVSNQPQG
232 -> 409 RAVVITFDDGLKSVSRYAYPVLKQYGMKATAFIVTSRIKRHPQKWNPKSLQFMSVSELNEIRDVFDFQSHTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAQFNPHVWYLSYPFGGFNDNAVKAANDAGFHLAVTTMKGKVKPGDNPLLLKRLYILRTDSLETMSRLVSNQPQG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016810 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
biological_process GO:0005975 - carbohydrate metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-11183N
ECOCYC:
EG11749-MONOMER
ECOLIWIKI:
b0130
INTERPRO:
IPR002509
INTERPRO:
IPR011330
MODBASE:
P31666
PFAM:
PF01522
PRIDE:
P31666
PROSITE:
PS51677
PROTEINMODELPORTAL:
P31666
REFSEQ:
NP_414672
SMR:
P31666
UNIPROT:
P31666


Operon      
Name: yadE         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yadEp3 144965 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yadEp4 145053 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB