RegulonDB RegulonDB 10.9: Gene Form
   

tsaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nnr amiB queG tsaE yjeV mutLp1 mutLp1 mutLp2 mutLp2 TSS_5011 TSS_5011 TSS_5010 TSS_5010 queGp queGp yjeFp3 yjeFp3 yjeFp2 yjeFp2 yjeFp1 yjeFp1

Gene      
Name: tsaE    Texpresso search in the literature
Synonym(s): ECK4164, EG11757, b4168, yjeE
Genome position(nucleotides): 4395585 --> 4396046 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.38
External database links:  
ASAP:
ABE-0013649
ECHOBASE:
EB1707
ECOLIHUB:
yjeE
OU-MICROARRAY:
b4168
STRING:
511145.b4168
COLOMBOS: tsaE


Product      
Name: N6-L-threonylcarbamoyladenine synthase, TsaE subunit
Synonym(s): TsaE, YjeE, tRNA adenosine(37) threonylcarbamoyltransferase complex, ATPase subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.853
Isoelectric point: 4.253
Motif(s):
 
Type Positions Sequence
38 -> 43 GAGKTT
9 -> 133 PDEQATLDLGERVAKACDGATVIYLYGDLGAGKTTFSRGFLQALGHQGNVKSPTYTLVEPYTLDNLMVYHFDLYRLADPEELEFMGIRDYFANDAICLVEWPQQGTGVLPDPDVEIHIDYQAQGR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0046872 - metal ion binding
GO:0004672 - protein kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
GO:0043531 - ADP binding
biological_process GO:0008033 - tRNA processing
GO:0046777 - protein autophosphorylation
GO:0002949 - tRNA threonylcarbamoyladenosine modification
Note(s): Note(s): ...[more].
Reference(s): [1] Meng J., et al., 2012
[2] Rajagopala SV., et al., 2010
External database links:  
DIP:
DIP-47867N
ECOCYC:
EG11757-MONOMER
ECOLIWIKI:
b4168
INTERPRO:
IPR027417
INTERPRO:
IPR003442
MODBASE:
P0AF67
PFAM:
PF02367
PRIDE:
P0AF67
REFSEQ:
NP_418589
SMR:
P0AF67
SWISSMODEL:
P0AF67
UNIPROT:
P0AF67


Operon      
Name: nnr-tsaE-amiB-mutL-miaA-hfq-hflXKC         
Operon arrangement:
Transcription unit        Promoter
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
miaA-hfq-hflXKC
miaA-hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
tsaE-amiB-mutL-miaA-hfq-hflXKC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5010 4395415 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5011 4395713 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Meng J., Kanzaki G., Meas D., Lam CK., Crummer H., Tain J., Xu HH., 2012, A genome-wide inducible phenotypic screen identifies antisense RNA constructs silencing Escherichia coli essential genes., FEMS Microbiol Lett 329(1):45-53

 [2] Rajagopala SV., Yamamoto N., Zweifel AE., Nakamichi T., Huang HK., Mendez-Rios JD., Franca-Koh J., Boorgula MP., Fujita K., Suzuki K., Hu JC., Wanner BL., Mori H., Uetz P., 2010, The Escherichia coli K-12 ORFeome: a resource for comparative molecular microbiology., BMC Genomics 11:470

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB