RegulonDB RegulonDB 10.8: Gene Form
   

pptA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydcC nhoA yddH pptA TSS_1827 TSS_1827 nhoAp2 nhoAp2 TSS_1826 TSS_1826 pptAp6 pptAp6 pptAp7 pptAp7

Gene      
Name: pptA    Texpresso search in the literature
Synonym(s): ECK1455, EG11761, b1461, ydcE
Genome position(nucleotides): 1533052 --> 1533285 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.16
External database links:  
ASAP:
ABE-0004875
ECHOBASE:
EB1711
OU-MICROARRAY:
b1461
PortEco:
pptA
STRING:
511145.b1461
COLOMBOS: pptA


Product      
Name: tautomerase PptA
Synonym(s): PptA, YdcE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.673
Isoelectric point: 4.66
Motif(s):
 
Type Positions Sequence
2 -> 53 PHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016862 - intramolecular oxidoreductase activity, interconverting keto- and enol-groups
GO:0016853 - isomerase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006725 - cellular aromatic compound metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Villa F., et al., 2012
External database links:  
ECOCYC:
EG11761-MONOMER
ECOLIWIKI:
b1461
INTERPRO:
IPR004370
INTERPRO:
IPR017284
INTERPRO:
IPR014347
MODBASE:
P31992
PDB:
1GYX
PDB:
1GYY
PDB:
1GYJ
PFAM:
PF01361
PRIDE:
P31992
PRODB:
PRO_000023583
REFSEQ:
NP_415978
SMR:
P31992
UNIPROT:
P31992


Operon      
Name: pptA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pptAp7 1532858 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter pptAp6 1532867 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1826 1533030 forward nd [RS-EPT-CBR] [3]
  promoter nhoAp2 1533963 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1827 1534000 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Villa F., Remelli W., Forlani F., Vitali A., Cappitelli F., 2012, Altered expression level of Escherichia coli proteins in response to treatment with the antifouling agent zosteric acid sodium salt., Environ Microbiol 14(7):1753-61

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB