RegulonDB RegulonDB 10.8: Gene Form
   

selU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

selU allS ylbG selUp5 selUp5 selUp4 selUp4 TSS_666 TSS_666

Gene      
Name: selU    Texpresso search in the literature
Synonym(s): ECK0496, EG11768, b0503, mnmH, ybbB
Genome position(nucleotides): 530132 <-- 531226 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.62
External database links:  
ASAP:
ABE-0001740
ECHOBASE:
EB1718
OU-MICROARRAY:
b0503
PortEco:
ybbB
STRING:
511145.b0503
COLOMBOS: selU


Product      
Name: tRNA 2-selenouridine synthase
Synonym(s): MnmH, SelU, YbbB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.111
Isoelectric point: 6.326
Motif(s):
 
Type Positions Sequence
14 -> 137 LIADTPIIDVRAPIEFEHGAMPAAINLPLMNNDERAAVGTCYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRSHIVQSWLHAAGIDYPLVEGGYKALRQTAIQATI
96 -> 96 C
97 -> 97 C

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016765 - transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0016740 - transferase activity
GO:0043828 - tRNA 2-selenouridine synthase activity
biological_process GO:0002098 - tRNA wobble uridine modification
GO:0070329 - tRNA seleno-modification
Note(s): Note(s): ...[more].
Reference(s): [1] Romero H., et al., 2005
[2] Sadosky AB., et al., 1991
External database links:  
ECOCYC:
EG11768-MONOMER
ECOLIWIKI:
b0503
INTERPRO:
IPR001763
INTERPRO:
IPR036873
INTERPRO:
IPR017582
MODBASE:
P33667
PRIDE:
P33667
PRODB:
PRO_000023933
PROSITE:
PS50206
REFSEQ:
NP_415036
SMART:
SM00450
SMR:
P33667
UNIPROT:
P33667


Operon      
Name: selU         
Operon arrangement:
Transcription unit        Promoter
ybbB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_666 531253 reverse nd [RS-EPT-CBR] [3]
  promoter selUp4 531358 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter selUp5 531362 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Romero H., Zhang Y., Gladyshev VN., Salinas G., 2005, Evolution of selenium utilization traits., Genome Biol 6(8):R66

 [2] Sadosky AB., Gray JA., Hill CW., 1991, The RhsD-E subfamily of Escherichia coli K-12., Nucleic Acids Res 19(25):7177-83

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB