RegulonDB RegulonDB 10.8: Gene Form
   

ybbC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhsD ylbH ybbD ylbG ybbC ylbI TSS_665 TSS_665

Gene      
Name: ybbC    Texpresso search in the literature
Synonym(s): ECK0492, EG11769, b0498
Genome position(nucleotides): 527581 --> 527949 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
30.62
External database links:  
ASAP:
ABE-0001726
ECHOBASE:
EB1719
OU-MICROARRAY:
b0498
PortEco:
ybbC
STRING:
511145.b0498
COLOMBOS: ybbC


Product      
Name: PF15631 family protein YbbC
Synonym(s): YbbC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 14.152
Isoelectric point: 5.766
Motif(s):
 
Type Positions Sequence
18 -> 122 CNETAVYGSDENIIFMRYVEKLHLDKYSVKNTVKTETMAIQLAEIYVRYRYGERIAEEEKPYLITELPDSWVVEGAKLPYEVAGGVFIIEINKKNGCVLNFLHSK
1 -> 17 MKYSSIFSMLSFFILFA
55 -> 122 MAIQLAEIYVRYRYGERIAEEEKPYLITELPDSWVVEGAKLPYEVAGGVFIIEINKKNGCVLNFLHSK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11316N
ECOCYC:
EG11769-MONOMER
ECOLIWIKI:
b0498
INTERPRO:
IPR028921
PFAM:
PF15631
PRIDE:
P33668
PROSITE:
PS51257
REFSEQ:
NP_415031
SMR:
P33668
UNIPROT:
P33668


Operon      
Name: rhsD-ybbC-ylbH-ybbD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_665 526934 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB