RegulonDB RegulonDB 10.8: Gene Form
   

ybbD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ylbH ybbD ylbG ybbC ylbI

Gene      
Name: ybbD    Texpresso search in the literature
Synonym(s): ECK0494, EG11770, b0500, b0501
Type: Pseudo Gene
Genome position(nucleotides): 528640 --> 529130 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
32.79
External database links:  
ASAP:
ABE-0001731
ECHOBASE:
EB1720
OU-MICROARRAY:
b0500
PortEco:
ybbD
STRING:
316407.85674639
COLOMBOS: ybbD


Product      
Name: putative uncharacterized protein YbbD
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 9.048
Motif(s):
 
Type Positions Sequence
12 -> 32 IIFIFAIIIIVVLCVITYLYL
68 -> 86 VDISIYTNVEDDYFFLIFP
1 -> 86 MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLPDFFPHVAVDISIYTNVEDDYFFLIFP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11770-MONOMER
ECOLIWIKI:
b0500
PRIDE:
P33669
REFSEQ:
NP_415033
UNIPROT:
P33669


Operon      
Name: rhsD-ybbC-ylbH-ybbD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB