RegulonDB RegulonDB 10.8: Gene Form
   

nuoF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nuoG nuoC nuoF nuoE nuoH Cis-reg TSS_2561 TSS_2561 TSS_2560 TSS_2560 TSS_2559 TSS_2559 TSS_2558 TSS_2558 TSS_2557 (cluster) TSS_2557 (cluster) TSS_2556 (cluster) TSS_2556 (cluster) TSS_2555 TSS_2555 TSS_2554 TSS_2554 TSS_2553 TSS_2553 TSS_2552 TSS_2552 TSS_2551 TSS_2551 TSS_2550 TSS_2550 TSS_2549 TSS_2549 TSS_2548 TSS_2548

Gene      
Name: nuoF    Texpresso search in the literature
Synonym(s): ECK2278, EG11774, b2284
Genome position(nucleotides): 2400218 <-- 2401555 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.2
External database links:  
ASAP:
ABE-0007545
CGSC:
32664
ECHOBASE:
EB1723
MIM:
252010
MIM:
256000
OU-MICROARRAY:
b2284
PortEco:
nuoF
STRING:
511145.b2284
COLOMBOS: nuoF


Product      
Name: NADH:quinone oxidoreductase subunit F
Synonym(s): NADH:ubiquinone oxidoreductase, chain F, NuoF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 49.292
Isoelectric point: 6.854
Motif(s):
 
Type Positions Sequence
54 -> 226 VKDAGLKGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEAAVNLRRAIAEATEAGLLGKNIMGTGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPFPATSGAWGKPTCVNNVETLCNVP
339 -> 421 VRNLEEFFARESCGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAHAPGAVEPLQSAIKYFREEFEA
38 -> 38 A
253 -> 295 SGRVKNPGLWELPFGTTAREILEDYAGGMRDGLKFKAWQPGGA
370 -> 370 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.D - Oxidoreduction-driven Active Transporters
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
GO:0030964 - NADH dehydrogenase complex
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0046872 - metal ion binding
GO:0016651 - oxidoreductase activity, acting on NAD(P)H
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008137 - NADH dehydrogenase (ubiquinone) activity
GO:0010181 - FMN binding
GO:0048038 - quinone binding
GO:0051287 - NAD binding
biological_process GO:0009060 - aerobic respiration
GO:0045333 - cellular respiration
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10382N
ECOCYC:
NUOF-MONOMER
ECOLIWIKI:
b2284
INTERPRO:
IPR011537
INTERPRO:
IPR037225
INTERPRO:
IPR037207
INTERPRO:
IPR019575
INTERPRO:
IPR001949
INTERPRO:
IPR011538
INTERPRO:
IPR019554
PANTHER:
PTHR11780
PFAM:
PF01512
PFAM:
PF10531
PFAM:
PF10589
PRIDE:
P31979
PRODB:
PRO_000023433
PROSITE:
PS00644
PROSITE:
PS00645
REFSEQ:
NP_416787
SMART:
SM00928
SMR:
P31979
UNIPROT:
P31979


Operon      
Name: nuoABCEFGHIJKLMN         
Operon arrangement:
Transcription unit        Promoter
nuoABCEFGHIJKLMN
nuoABCEFGHIJKLMN
nuoMN


Transcriptional Regulation      
Display Regulation             
Activated by: NarL, Fis
Repressed by: FNR, IHF, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2548 2397784 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2549 2398792 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2550 2399056 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2551 2401472 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2552 2401657 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2553 2401712 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2554 2401816 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2555 2401828 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2556 (cluster) 2402077 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2557 (cluster) 2402082 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2558 2402223 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2559 2402324 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2560 2402420 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2561 2403030 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB