RegulonDB RegulonDB 10.7: Gene Form
   

ybfF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybfF seqA ybfE LexA TSS_826 TSS_826 TSS_825 TSS_825 seqAp seqAp TSS_824 (cluster) TSS_824 (cluster) TSS_823 TSS_823 ybfFp1 ybfFp1 TSS_822 TSS_822 ybfEp ybfEp

Gene      
Name: ybfF    Texpresso search in the literature
Synonym(s): ECK0674, EG11776, b0686
Genome position(nucleotides): 712038 <-- 712802 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.85
External database links:  
ASAP:
ABE-0002337
ECHOBASE:
EB1725
OU-MICROARRAY:
b0686
PORTECO:
ybfF
REGULONDB:
b0686
STRING:
511145.b0686
M3D: ybfF
COLOMBOS: ybfF
PortEco: b0686


Product      
Name: esterase
Synonym(s): YbfF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.437
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
19 -> 246 IVLVHGLFGSLDNLGVLARDLVNDHNIIQVDMRNHGLSPRDPVMNYPAMAQDLVDTLDAQQIDKATFIGHSMGGKAVMALTALASDRIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDAQTRQQAAAIMRQHLNEEGVIQFLLKSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPYVSEQYRDDLLAQFPQARAHVIAGAGHWVHAEKPDAVLR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016790 - thiolester hydrolase activity
GO:0052689 - carboxylic ester hydrolase activity
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Kuznetsova E., et al., 2005
External database links:  
ECOCYC:
EG11776-MONOMER
ECOLIWIKI:
b0686
INTERPRO:
IPR000073
INTERPRO:
IPR029058
MODBASE:
P75736
PDB:
3BF7
PDB:
3BF8
PFAM:
PF12697
PRIDE:
P75736
PROTEINMODELPORTAL:
P75736
REFSEQ:
NP_415212
SMR:
P75736
UNIPROT:
P75736


Operon      
Name: ybfF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_822 712843 reverse nd [RS-EPT-CBR] [2]
  promoter ybfFp1 712846 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_823 712851 forward nd [RS-EPT-CBR] [2]
  promoter TSS_824 (cluster) 712916 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_825 713180 forward nd [RS-EPT-CBR] [2]
  promoter TSS_826 713441 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kuznetsova E., Proudfoot M., Sanders SA., Reinking J., Savchenko A., Arrowsmith CH., Edwards AM., Yakunin AF., 2005, Enzyme genomics: Application of general enzymatic screens to discover new enzymes., FEMS Microbiol Rev 29(2):263-79

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB