RegulonDB RegulonDB 10.8: Gene Form
   

smpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

smpB ratA ssrA yfjF anti-terminator anti-anti-terminator anti-anti-terminator anti-terminator terminator ssrAp ssrAp ssrAp2 ssrAp2 smpBp5 smpBp5

Gene      
Name: smpB    Texpresso search in the literature
Synonym(s): ECK2616, EG11782, b2620, smqB
Genome position(nucleotides): 2754896 --> 2755378 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.76
External database links:  
ASAP:
ABE-0008622
ECHOBASE:
EB1730
OU-MICROARRAY:
b2620
PortEco:
smpB
STRING:
511145.b2620
COLOMBOS: smpB


Product      
Name: SsrA-binding protein
Synonym(s): SmpB, SmqB, small protein B
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.269
Isoelectric point: 10.526
Motif(s):
 
Type Positions Sequence
2 -> 160 TKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR
139 -> 139 R
154 -> 160 IMKNAHR
14 -> 157 IALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKN
137 -> 139 DKR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003723 - RNA binding
biological_process GO:0070929 - trans-translation
GO:0070930 - trans-translation-dependent protein tagging
Note(s): Note(s): ...[more].
Evidence: [AUP] Assay of unpurified protein
[IMP] Inferred from mutant phenotype
Reference(s): [1] Hanawa-Suetsugu K., et al., 2002
[2] Miczak A., et al., 1991
[3] Sharan M., et al., 2017
External database links:  
DIP:
DIP-47871N
ECOCYC:
EG11782-MONOMER
ECOLIWIKI:
b2620
INTERPRO:
IPR023620
INTERPRO:
IPR020081
INTERPRO:
IPR000037
MINT:
MINT-1229819
PANTHER:
PTHR30308
PDB:
6Q97
PFAM:
PF01668
PRIDE:
P0A832
PRODB:
PRO_000023962
PRODOM:
PD004488
PROSITE:
PS01317
REFSEQ:
NP_417110
SMR:
P0A832
SWISSMODEL:
P0A832
UNIPROT:
P0A832


Operon      
Name: smpB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter smpBp5 2754767 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ssrAp2 2755507 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hanawa-Suetsugu K., Takagi M., Inokuchi H., Himeno H., Muto A., 2002, SmpB functions in various steps of trans-translation., Nucleic Acids Res 30(7):1620-9

 [2] Miczak A., Chauhan AK., Apirion D., 1991, Two new genes located between 2758 and 2761 kilobase pairs on the Escherichia coli genome., J Bacteriol 173(11):3271-2

 [3] Sharan M., Forstner KU., Eulalio A., Vogel J., 2017, APRICOT: an integrated computational pipeline for the sequence-based identification and characterization of RNA-binding proteins., Nucleic Acids Res 45(11):e96

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB