RegulonDB RegulonDB 10.7: Gene Form
   

intA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

intA yfjH ssrA terminator anti-terminator anti-anti-terminator TSS_2971 TSS_2971

Gene      
Name: intA    Texpresso search in the literature
Synonym(s): ECK2618, EG11783, b2622, intX, slpA
Genome position(nucleotides): 2756159 --> 2757400 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.58
External database links:  
ASAP:
ABE-0008630
CGSC:
33082
ECHOBASE:
EB1731
ECOO157CYC:
INTL
ECOO157CYC:
Z5890
ECOO157CYC:
Z1835
ECOO157CYC:
Z1559
ECOO157CYC:
Z0324
ECOO157CYC:
Z1120
OU-MICROARRAY:
b2622
PORTECO:
intA
REGULONDB:
b2622
STRING:
511145.b2622
M3D: intA
COLOMBOS: intA
PortEco: b2622


Shine dalgarno      
Sequence: ctaaacgcagGGAGACtccccATG


Product      
Name: CP4-57 prophage; integrase IntA
Synonym(s): IntA, IntX, SlpA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 46.652
Isoelectric point: 10.189
Motif(s):
 
Type Positions Sequence
8 -> 95 LTDTEIKAAKPKDADYQLYDGDGLTLLIKSSGSKLWQFRYYRPLTKQRTKQSFGAYPAVSLSDARKLRAESKVLLAKDIDPQEHQKEQ
214 -> 377 IRPDQLPQLMHTMRTASISMSTRCLFMWQLLTITRPAEAAEARWDEIDFNASEWKIPAARMKMNRDHTVPLSDGALAILEMMKPLSGGREFIFPSRIKPNQPMNSQTVNAALKRAGLGGVLVSHGLRSIASTALNEEGFPPDVIEAALAHVDKNEVRRAYNRSD
209 -> 386 KNMPSIRPDQLPQLMHTMRTASISMSTRCLFMWQLLTITRPAEAAEARWDEIDFNASEWKIPAARMKMNRDHTVPLSDGALAILEMMKPLSGGREFIFPSRIKPNQPMNSQTVNAALKRAGLGGVLVSHGLRSIASTALNEEGFPPDVIEAALAHVDKNEVRRAYNRSDYLEQRRPMM

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0008979 - prophage integrase activity
biological_process GO:0044826 - viral genome integration into host DNA
GO:0006310 - DNA recombination
GO:0015074 - DNA integration
GO:0032359 - provirus excision
GO:0046718 - viral entry into host cell
GO:0075713 - establishment of integrated proviral latency
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10034N
ECOCYC:
EG11783-MONOMER
ECOLIWIKI:
b2622
ECOO157CYC:
Z0324-MONOMER
ECOO157CYC:
Z1559-MONOMER
ECOO157CYC:
Z1120-MONOMER
ECOO157CYC:
Z1835-MONOMER
ECOO157CYC:
Z5890-MONOMER
ECOO157CYC:
INTL-MONOMER
INTERPRO:
IPR038488
INTERPRO:
IPR002104
INTERPRO:
IPR025166
INTERPRO:
IPR013762
INTERPRO:
IPR011010
INTERPRO:
IPR010998
MINT:
MINT-1219095
MODBASE:
P32053
PFAM:
PF00589
PFAM:
PF13356
PRIDE:
P32053
PRODB:
PRO_000023025
PROSITE:
PS51898
PROTEINMODELPORTAL:
P32053
REFSEQ:
NP_417111
SMR:
P32053
UNIPROT:
P32053


Operon      
Name: intA         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2971 2756133 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB