RegulonDB RegulonDB 10.8: Gene Form
   

yfiE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

srmB yfiE eamB yfiEp7 yfiEp7

Gene      
Name: yfiE    Texpresso search in the literature
Synonym(s): ECK2575, EG11785, b2577
Genome position(nucleotides): 2714439 <-- 2715320 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.66
External database links:  
ASAP:
ABE-0008483
ECHOBASE:
EB1733
OU-MICROARRAY:
b2577
PortEco:
yfiE
STRING:
511145.b2577
COLOMBOS: yfiE


Product      
Name: putative LysR-type DNA-binding transcriptional regulator YfiE
Synonym(s): YfiE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 33.243
Isoelectric point: 6.766
Motif(s):
 
Type Positions Sequence
3 -> 62 LRRFITLKTVVEEGSFLRASQKLCCTQSTVTFHIQQLEQEFSVQLFEKIGRRMCLTREGK
87 -> 289 DPDGELRVVSGETLLSYRMPQVLQRFRQRAPKVRLSLQSLNCYVIRDALLNDEADVGVFYRVGNDDALNRRELGEQSLVLVASPQIADVDFTEPGRHNACSFIINEPQCVFRQIFESTLRQRRITVENTIELISIESIKRCVAANIGVSYLPRFAVAKELECGELIELPFGEQSQTITAMCAHHAGKAVSPAMHTFIQCVEES
18 -> 37 FLRASQKLCCTQSTVTFHIQ
1 -> 58 MDLRRFITLKTVVEEGSFLRASQKLCCTQSTVTFHIQQLEQEFSVQLFEKIGRRMCLT
209 -> 293 RITVENTIELISIESIKRCVAANIGVSYLPRFAVAKELECGELIELPFGEQSQTITAMCAHHAGKAVSPAMHTFIQCVEESFVAG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0044212 - transcription regulatory region DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
EG11785-MONOMER
ECOLIWIKI:
b2577
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR005119
INTERPRO:
IPR000847
MODBASE:
P33634
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P33634
PROSITE:
PS50931
REFSEQ:
NP_417072
SMR:
P33634
UNIPROT:
P33634


Operon      
Name: yfiE         
Operon arrangement:
Transcription unit        Promoter
yfiE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfiEp7 2715344 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB