RegulonDB RegulonDB 10.8: Gene Form
   

yfiF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfiF ung trxC OxyR OxyR terminator TSS_2892 TSS_2892 trxCp trxCp TSS_2891 TSS_2891 TSS_2890 (cluster) TSS_2890 (cluster)

Gene      
Name: yfiF    Texpresso search in the literature
Synonym(s): ECK2579, EG11786, b2581
Genome position(nucleotides): 2717491 <-- 2718528 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.26
External database links:  
ASAP:
ABE-0008497
ECHOBASE:
EB1734
OU-MICROARRAY:
b2581
PortEco:
yfiF
STRING:
511145.b2581
COLOMBOS: yfiF


Product      
Name: putative methyltransferase YfiF
Synonym(s): YfiF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.784
Isoelectric point: 9.136
Motif(s):
 
Type Positions Sequence
199 -> 336 VLALENESNPHNLGGMMRSCAHFGVKGVVVQDAALLESGAAIRTAEGGAEHVQPITGDNIVNVLDDFRQAGYTVVTTSSEQGKPLFKTSLPAKMVLVLGQEYEGLPDAARDPNDLRVKIDGTGNVAGLNISVATGVLL
110 -> 181 VYGENACQALFQSRPEAIVRAWFIQSVTPRFKEALRWMAANRKAYHVVDEAELTKASGTEHHGGVCFLIKKR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0008173 - RNA methyltransferase activity
GO:0003723 - RNA binding
biological_process GO:0001510 - RNA methylation
GO:0006396 - RNA processing
GO:0032259 - methylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47835N
ECOCYC:
EG11786-MONOMER
ECOLIWIKI:
b2581
INTERPRO:
IPR029064
INTERPRO:
IPR029028
INTERPRO:
IPR016479
INTERPRO:
IPR029026
INTERPRO:
IPR001537
INTERPRO:
IPR013123
MINT:
MINT-1218417
MODBASE:
P0AGJ5
PANTHER:
PTHR46429:SF2
PFAM:
PF00588
PFAM:
PF08032
PRIDE:
P0AGJ5
REFSEQ:
NP_417076
SMART:
SM00967
SMR:
P0AGJ5
UNIPROT:
P0AGJ5


Operon      
Name: yfiF         
Operon arrangement:
Transcription unit        Promoter
yfiF


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2890 (cluster) 2718554 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2891 2718593 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2892 2718965 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB